Difference between revisions of "Os03g0741100"

From RiceWiki
Jump to: navigation, search
(Annotated Information)
(Annotated Information)
Line 1: Line 1:
 
''OsbHLH148'' is a basic helix-loop-helix protein, and it interacts with OsJAZ proteins in a jasmonate signalling pathway leading to drought tolerance in rice.
 
''OsbHLH148'' is a basic helix-loop-helix protein, and it interacts with OsJAZ proteins in a jasmonate signalling pathway leading to drought tolerance in rice.
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os03g0741100''''' '''<=>''' '''''OsbHLH148,bHLH148'''''
 
===Function===
 
===Function===
''OsbHLH148'' interacts with ''OsJAZ'' proteins in a jasmonate signalling pathway leading to drought tolerance in rice. The over-expressed ''OsbHLH148'' can cause the up-regulation of some genes involved in stress responses and the jasmonate signalling pathway  such as OsDREB and OsJAZ genes. ''OsbHLH14''8 acts in the initial response of jasmonates by forming an OsbHLH148–OsJAZ1–OsCOI1 signalling module in the upstream signalling pathway to improve drought tolerance in rice<ref name="ref1" />.
+
* ''OsbHLH148'' interacts with ''OsJAZ'' proteins in a jasmonate signalling pathway leading to drought tolerance in rice. The over-expressed ''OsbHLH148'' can cause the up-regulation of some genes involved in stress responses and the jasmonate signalling pathway  such as OsDREB and OsJAZ genes. ''OsbHLH14''8 acts in the initial response of jasmonates by forming an OsbHLH148–OsJAZ1–OsCOI1 signalling module in the upstream signalling pathway to improve drought tolerance in rice<ref name="ref1" />.
  
 
===Expression===
 
===Expression===
 +
* As figure1 shows, ''OsbHLH148'' transcript levels were rapidly increased by treatment with methyl jasmonate (MeJA) or abscisic acid, and abiotic stresses including dehydration, high salinity, low temperature and wounding<ref name="ref1" />。[[File:Expression.gif|thumb|right|''Figure1: OsDREB148 was rapidly induced by 15 min of exposure to MeJA and was gradually responsive to drought conditions(from reference <ref name="ref1" />).'']].
  
As figure1 shows, ''OsbHLH148'' transcript levels were rapidly increased by treatment with methyl jasmonate (MeJA) or abscisic acid, and abiotic stresses including dehydration, high salinity, low temperature and wounding<ref name="ref1" />。[[File:Expression.gif|thumb|right|''Figure1: OsDREB148 was rapidly induced by 15 min of exposure to MeJA and was gradually responsive to drought conditions(from reference <ref name="ref1" />).'']].
 
 
===Evolution===
 
Please input evolution information here.
 
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.

Revision as of 14:47, 6 May 2017

OsbHLH148 is a basic helix-loop-helix protein, and it interacts with OsJAZ proteins in a jasmonate signalling pathway leading to drought tolerance in rice.

Annotated Information

Gene Symbol

  • Os03g0741100 <=> OsbHLH148,bHLH148

Function

  • OsbHLH148 interacts with OsJAZ proteins in a jasmonate signalling pathway leading to drought tolerance in rice. The over-expressed OsbHLH148 can cause the up-regulation of some genes involved in stress responses and the jasmonate signalling pathway such as OsDREB and OsJAZ genes. OsbHLH148 acts in the initial response of jasmonates by forming an OsbHLH148–OsJAZ1–OsCOI1 signalling module in the upstream signalling pathway to improve drought tolerance in rice[1].

Expression

  • As figure1 shows, OsbHLH148 transcript levels were rapidly increased by treatment with methyl jasmonate (MeJA) or abscisic acid, and abiotic stresses including dehydration, high salinity, low temperature and wounding[1]
    Figure1: OsDREB148 was rapidly induced by 15 min of exposure to MeJA and was gradually responsive to drought conditions(from reference [1]).
    .


You can also add sub-section(s) at will.

Labs working on this gene

  • Department of Agricultural Biotechnology, Seoul National University, Seoul 151-921, Korea
  • Division of Bioscience and Bioinformatics, Myongi University, Yongin 449-728, Korea
  • GreenGene Biotech Inc., Myongji University, Yongin 449-728, Korea
  • School of Biological Science, Seoul National University, Seoul 151-742, Korea

References

<references> [1]

Structured Information

Gene Name

Os03g0741100

Description

Basic helix-loop-helix dimerisation region bHLH domain containing protein

Version

NM_001057756.1 GI:115455240 GeneID:4334060

Length

2513 bp

Definition

Oryza sativa Japonica Group Os03g0741100, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 3

Location

Chromosome 3:31169988..31172500

Sequence Coding Region

31170066..31170542,31170910..31171197,31172163..31172297

Expression

GEO Profiles:Os03g0741100

Genome Context

<gbrowseImage1> name=NC_008396:31169988..31172500 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008396:31169988..31172500 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgcaaatggagtcgtactacggcgcgttccacgccgacgaggccgcgttcttcttcccccaccacgtgccggcgtcgccggagctgccgttcggcctcattgcgtcgccggagccggagccggagccggagcaggcggcggcggaggcgaggcagagcgcgttccaggagtacggcggcgcggtgcacgccggagcgccggcggcggcgggggctgtcaccaccggtgggacgaacatccaccggagggtgatggacgtgctgggcaggatgggcggcggcggcggcgggggggagaagggggagggtgaggagatggaggaggaggaggaggtgccgcagcggcggcggcgcgggcagggcgccgacgtggagagcagccgcggtttccgccacatgatgcgcgagcgccagcgccgcgagaagctcagccagagctacgccgacctctacgccatggtctcctctcgctccaagggggacaagaactcgatcgtgcagtcggcggcgatctacatccacgagctgaaggtcgcgagggaccagctgcagaggaggaacgaggagctgaaggcccagatcatgggccacgacgagcagcagccgtgcgtcacggtgcagttcgaggtcgacgagccgtcgtcgtcgatcgactccatgatcgccgcgctccggcggctcaagggcatgagcgtcaaggcgcgcgggatccggtcgagcatgtccgggaacaggctgtggacggagatgaacgtcgagaccacgattgcggcttgtgaagtggaaaaggcagtggaagaggctctcaaggaagtagagaggaaccagcctgacagcgatgccccatttcctggaagcaaaggctggacacagacatctcatgtgcaaaatgtgttttga</cdnaseq>

Protein Sequence

<aaseq>MQMESYYGAFHADEAAFFFPHHVPASPELPFGLIASPEPEPEPE QAAAEARQSAFQEYGGAVHAGAPAAAGAVTTGGTNIHRRVMDVLGRMGGGGGGGEKGE GEEMEEEEEVPQRRRRGQGADVESSRGFRHMMRERQRREKLSQSYADLYAMVSSRSKG DKNSIVQSAAIYIHELKVARDQLQRRNEELKAQIMGHDEQQPCVTVQFEVDEPSSSID SMIAALRRLKGMSVKARGIRSSMSGNRLWTEMNVETTIAACEVEKAVEEALKEVERNQ PDSDAPFPGSKGWTQTSHVQNVF</aaseq>

Gene Sequence

<dnaseqindica>79..555#923..1210#2176..2310#ggaaaccatcgccaaccatcacatctgatcgagaacaagaagaagaagaagaagaagcaagaacagcaagaggaagagatgcaaatggagtcgtactacggcgcgttccacgccgacgaggccgcgttcttcttcccccaccacgtgccggcgtcgccggagctgccgttcggcctcattgcgtcgccggagccggagccggagccggagcaggcggcggcggaggcgaggcagagcgcgttccaggagtacggcggcgcggtgcacgccggagcgccggcggcggcgggggctgtcaccaccggtgggacgaacatccaccggagggtgatggacgtgctgggcaggatgggcggcggcggcggcgggggggagaagggggagggtgaggagatggaggaggaggaggaggtgccgcagcggcggcggcgcgggcagggcgccgacgtggagagcagccgcggtttccgccacatgatgcgcgagcgccagcgccgcgagaagctcagccagagctacgccgacctctacgccatggtctcctctcgctccaaggttcgtcggcctcctctgctcacagcctaagcttatcactctcacttagtactctacttcacttcgccgctcacttcatttcaagctccatttcatctttcacctagattccatcgagaaatgcctaatgtagactgctaatttggccttctttaagctcagattttcgtttaccatcgcattgtcccatttcattggcttcaatttgcctcttcttgatttccccaatgttaatctgaaattcagagcatcttcagctcaaaccaattctgttcagcttcagaatgttcgaaatccccctttaatacctcttaaatggagtgtttaccaaaatcgggctgacaaaaaaccgttcgtgtcactgcagggggacaagaactcgatcgtgcagtcggcggcgatctacatccacgagctgaaggtcgcgagggaccagctgcagaggaggaacgaggagctgaaggcccagatcatgggccacgacgagcagcagccgtgcgtcacggtgcagttcgaggtcgacgagccgtcgtcgtcgatcgactccatgatcgccgcgctccggcggctcaagggcatgagcgtcaaggcgcgcgggatccggtcgagcatgtccgggaacaggctgtggacggagatgaacgtcgagaccacggtgagagctctctctctctctctctctctctctccccccccccccccccccccccccccccccccccccccccttggcttgcaattcttgaaaatttttgcattttttcccctctgaacttagcctacctgccttgttgacagtaactgtcagagttttaattaggttaggaaagatgcagcagttcgtctcctacaagattagcctcattttcgtgttttatcaatacactgtatcttgccttggatagctacggattagattgttacgtacagtagtagataggaaaccgtagtggcaacgggataactggataaggatgaagagttctaatcaacttcagaaatggaagatggaagcatattggttgggagaatttgggctatttttttttcgaataagaagaatttgggctaaattagagaagcatcagagtaacgtttccgaaggaaaagattagtgcagtaattttgctgaactattttatatcctgtccacttgaggtcaagatgcaggaattccactcgaaaccccccaatttgacattagtcaaccgtgtcaagagttcttgtcgaatcttttggtttatgcataaatcatttagcagatcctcaaccccaagaccccaattacaaatagctgtaattagaggtttaattaatcagcaactgttgttagttagcactggtcatccaactgccaaatcaatctttcctcaaaagattattacaagtagttcacaaacatccaaacatgatctttcaaaaggaaacatccaaattccaaacagccataccatattttatactacagagcaacaatcggggccaattacagtccatgcctatccaatattaaactgaaaaagtttattataattataacactagcagttgattaataatagtaagccaattgtacactctaactaacgacgtttaatttcgcatgtgtcattttcacagattgcggcttgtgaagtggaaaaggcagtggaagaggctctcaaggaagtagagaggaaccagcctgacagcgatgccccatttcctggaagcaaaggctggacacagacatctcatgtgcaaaatgtgttttgatcggttttgaaacatgatcctgctgggacccccatttgttcatttttttaaaagcttgtgatggagcaagtggaaaaaaaatctccatatctccttgtcaatgtaccttttttttgtccatgtagatacaatcatacaaataatagcttcctctcttttctacaaggaaaaaagaaagagaagagtacaaaaaagatttaagc</dnaseqindica>

External Link(s)

NCBI Gene:Os03g0741100, RefSeq:Os03g0741100

  1. 1.0 1.1 1.2 1.3 Ju-Seok Seo1, Joungsu Joo2, Min-Jeong Kim1, Yang Do Choi1 et al.(2011) OsbHLH148, a basic helix-loop-helix protein, interacts with OsJAZ proteins in a jasmonate signaling pathway leading to drought tolerance in rice.The Plant Journal Volume 65, Issue 6:907–921.