|
|
| (26 intermediate revisions by 2 users not shown) |
| Line 1: |
Line 1: |
| − | Please input one-sentence summary here.
| + | ''OsbHLH148'' is a basic helix-loop-helix protein, and it interacts with OsJAZ proteins in a jasmonate signalling pathway leading to drought tolerance in rice. |
| | + | ==Annotated Information== |
| | + | ===Gene Symbol=== |
| | + | *'''''Os03g0741100''''' '''<=>''' '''''OsbHLH148,bHLH148''''' |
| | | | |
| − | ==Annotated Information==
| |
| | ===Function=== | | ===Function=== |
| − | OsbHLH148 is a basic helix-loop-helix protein, which interacts with OsJAZ proteins in a jasmonate signaling pathway leading to drought tolerance in rice. The over-expressed OsbHLH148 can cause the up-regulation of some genes involved in stress responses and the jasmonate signaling pathway such as OsDREB and OsJAZ genes. OsbHLH148 acts in the initial response of jasmonates by forming an OsbHLH148–OsJAZ1–OsCOI1 signaling module in the upstream signaling pathway to improve drought tolerance in rice. | + | * ''OsbHLH148'' interacts with ''OsJAZ'' proteins in a jasmonate signalling pathway leading to drought tolerance in rice. The over-expressed ''OsbHLH148'' can cause the up-regulation of some genes involved in stress responses and the jasmonate signalling pathway such as OsDREB and OsJAZ genes. ''OsbHLH14''8 acts in the initial response of jasmonates by forming an OsbHLH148–OsJAZ1–OsCOI1 signalling module in the upstream signalling pathway to improve drought tolerance in rice<ref name="ref1" />. |
| | | | |
| | ===Expression=== | | ===Expression=== |
| − | | + | * ''OsbHLH148'' transcript levels were rapidly increased by treatment with methyl jasmonate (MeJA) or abscisic acid, and abiotic stresses including dehydration, high salinity, low temperature and wounding<ref name="ref1" /> |
| − | OsbHLH148 transcript levels were rapidly increased by treatment with methyl jasmonate (MeJA) or abscisic acid, and abiotic stresses including dehydration, high salinity, low temperature and wounding.[[Media:C:\Users\sx14\Desktop\expression]] | |
| − | | |
| − | ===Evolution=== | |
| − | Please input evolution information here.
| |
| | | | |
| | You can also add sub-section(s) at will. | | You can also add sub-section(s) at will. |
| | | | |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| − | Department of Agricultural Biotechnology, Seoul National University, Seoul 151-921, Korea | + | *Department of Agricultural Biotechnology, Seoul National University, Seoul 151-921, Korea |
| − | | + | *Division of Bioscience and Bioinformatics, Myongi University, Yongin 449-728, Korea |
| − | Division of Bioscience and Bioinformatics, Myongi University, Yongin 449-728, Korea | + | *GreenGene Biotech Inc., Myongji University, Yongin 449-728, Korea |
| − | | + | *School of Biological Science, Seoul National University, Seoul 151-742, Korea |
| − | GreenGene Biotech Inc., Myongji University, Yongin 449-728, Korea | |
| − | | |
| − | School of Biological Science, Seoul National University, Seoul 151-742, Korea | |
| | | | |
| | ==References== | | ==References== |
| − | 1. Ju-Seok Seo1, Joungsu Joo2, Min-Jeong Kim1, Yang Do Choi1 et al.(2011) OsbHLH148, a basic helix-loop-helix protein, interacts with OsJAZ proteins in a jasmonate signaling pathway leading to drought tolerance in rice.The Plant Journal
| + | <references> |
| − | Volume 65, Issue 6:907–921 | + | <ref name="ref1">Ju-Seok Seo1, Joungsu Joo2, Min-Jeong Kim1, Yang Do Choi1 et al.(2011) OsbHLH148, a basic helix-loop-helix protein, interacts with OsJAZ proteins in a jasmonate signaling pathway leading to drought tolerance in rice.The Plant Journal |
| | + | Volume 65, Issue 6:907–921.</ref> |
| | + | </references> |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| |
| − | GeneName = Os03g0741100|
| |
| − | Description = Basic helix-loop-helix dimerisation region bHLH domain containing protein|
| |
| − | Version = NM_001057756.1 GI:115455240 GeneID:4334060|
| |
| − | Length = 2513 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os03g0741100, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| | | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|
| |
| − | AP = Chromosome 3:31169988..31172500|
| |
| − | CDS = 31170066..31170542,31170910..31171197,31172163..31172297|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008396:31169988..31172500
| |
| − | source=RiceChromosome03
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008396:31169988..31172500
| |
| − | source=RiceChromosome03
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atgcaaatggagtcgtactacggcgcgttccacgccgacgaggccgcgttcttcttcccccaccacgtgccggcgtcgccggagctgccgttcggcctcattgcgtcgccggagccggagccggagccggagcaggcggcggcggaggcgaggcagagcgcgttccaggagtacggcggcgcggtgcacgccggagcgccggcggcggcgggggctgtcaccaccggtgggacgaacatccaccggagggtgatggacgtgctgggcaggatgggcggcggcggcggcgggggggagaagggggagggtgaggagatggaggaggaggaggaggtgccgcagcggcggcggcgcgggcagggcgccgacgtggagagcagccgcggtttccgccacatgatgcgcgagcgccagcgccgcgagaagctcagccagagctacgccgacctctacgccatggtctcctctcgctccaagggggacaagaactcgatcgtgcagtcggcggcgatctacatccacgagctgaaggtcgcgagggaccagctgcagaggaggaacgaggagctgaaggcccagatcatgggccacgacgagcagcagccgtgcgtcacggtgcagttcgaggtcgacgagccgtcgtcgtcgatcgactccatgatcgccgcgctccggcggctcaagggcatgagcgtcaaggcgcgcgggatccggtcgagcatgtccgggaacaggctgtggacggagatgaacgtcgagaccacgattgcggcttgtgaagtggaaaaggcagtggaagaggctctcaaggaagtagagaggaaccagcctgacagcgatgccccatttcctggaagcaaaggctggacacagacatctcatgtgcaaaatgtgttttga</cdnaseq>|
| |
| − | AA = <aaseq>MQMESYYGAFHADEAAFFFPHHVPASPELPFGLIASPEPEPEPE QAAAEARQSAFQEYGGAVHAGAPAAAGAVTTGGTNIHRRVMDVLGRMGGGGGGGEKGE GEEMEEEEEVPQRRRRGQGADVESSRGFRHMMRERQRREKLSQSYADLYAMVSSRSKG DKNSIVQSAAIYIHELKVARDQLQRRNEELKAQIMGHDEQQPCVTVQFEVDEPSSSID SMIAALRRLKGMSVKARGIRSSMSGNRLWTEMNVETTIAACEVEKAVEEALKEVERNQ PDSDAPFPGSKGWTQTSHVQNVF</aaseq>|
| |
| − | DNA = <dnaseqindica>79..555#923..1210#2176..2310#ggaaaccatcgccaaccatcacatctgatcgagaacaagaagaagaagaagaagaagcaagaacagcaagaggaagagatgcaaatggagtcgtactacggcgcgttccacgccgacgaggccgcgttcttcttcccccaccacgtgccggcgtcgccggagctgccgttcggcctcattgcgtcgccggagccggagccggagccggagcaggcggcggcggaggcgaggcagagcgcgttccaggagtacggcggcgcggtgcacgccggagcgccggcggcggcgggggctgtcaccaccggtgggacgaacatccaccggagggtgatggacgtgctgggcaggatgggcggcggcggcggcgggggggagaagggggagggtgaggagatggaggaggaggaggaggtgccgcagcggcggcggcgcgggcagggcgccgacgtggagagcagccgcggtttccgccacatgatgcgcgagcgccagcgccgcgagaagctcagccagagctacgccgacctctacgccatggtctcctctcgctccaaggttcgtcggcctcctctgctcacagcctaagcttatcactctcacttagtactctacttcacttcgccgctcacttcatttcaagctccatttcatctttcacctagattccatcgagaaatgcctaatgtagactgctaatttggccttctttaagctcagattttcgtttaccatcgcattgtcccatttcattggcttcaatttgcctcttcttgatttccccaatgttaatctgaaattcagagcatcttcagctcaaaccaattctgttcagcttcagaatgttcgaaatccccctttaatacctcttaaatggagtgtttaccaaaatcgggctgacaaaaaaccgttcgtgtcactgcagggggacaagaactcgatcgtgcagtcggcggcgatctacatccacgagctgaaggtcgcgagggaccagctgcagaggaggaacgaggagctgaaggcccagatcatgggccacgacgagcagcagccgtgcgtcacggtgcagttcgaggtcgacgagccgtcgtcgtcgatcgactccatgatcgccgcgctccggcggctcaagggcatgagcgtcaaggcgcgcgggatccggtcgagcatgtccgggaacaggctgtggacggagatgaacgtcgagaccacggtgagagctctctctctctctctctctctctctccccccccccccccccccccccccccccccccccccccccttggcttgcaattcttgaaaatttttgcattttttcccctctgaacttagcctacctgccttgttgacagtaactgtcagagttttaattaggttaggaaagatgcagcagttcgtctcctacaagattagcctcattttcgtgttttatcaatacactgtatcttgccttggatagctacggattagattgttacgtacagtagtagataggaaaccgtagtggcaacgggataactggataaggatgaagagttctaatcaacttcagaaatggaagatggaagcatattggttgggagaatttgggctatttttttttcgaataagaagaatttgggctaaattagagaagcatcagagtaacgtttccgaaggaaaagattagtgcagtaattttgctgaactattttatatcctgtccacttgaggtcaagatgcaggaattccactcgaaaccccccaatttgacattagtcaaccgtgtcaagagttcttgtcgaatcttttggtttatgcataaatcatttagcagatcctcaaccccaagaccccaattacaaatagctgtaattagaggtttaattaatcagcaactgttgttagttagcactggtcatccaactgccaaatcaatctttcctcaaaagattattacaagtagttcacaaacatccaaacatgatctttcaaaaggaaacatccaaattccaaacagccataccatattttatactacagagcaacaatcggggccaattacagtccatgcctatccaatattaaactgaaaaagtttattataattataacactagcagttgattaataatagtaagccaattgtacactctaactaacgacgtttaatttcgcatgtgtcattttcacagattgcggcttgtgaagtggaaaaggcagtggaagaggctctcaaggaagtagagaggaaccagcctgacagcgatgccccatttcctggaagcaaaggctggacacagacatctcatgtgcaaaatgtgttttgatcggttttgaaacatgatcctgctgggacccccatttgttcatttttttaaaagcttgtgatggagcaagtggaaaaaaaatctccatatctccttgtcaatgtaccttttttttgtccatgtagatacaatcatacaaataatagcttcctctcttttctacaaggaaaaaagaaagagaagagtacaaaaaagatttaagc</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001057756.1 RefSeq:Os03g0741100]|
| |
| − | }}
| |
| | [[Category:Genes]] | | [[Category:Genes]] |
| | [[Category:Japonica mRNA]] | | [[Category:Japonica mRNA]] |