Difference between revisions of "Os05g0107700"

From RiceWiki
Jump to: navigation, search
(Evolution)
(References)
 
(29 intermediate revisions by 7 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os05g0107700''''' was reported as '''''2003''''' in 2003 by researchers from USA.  
  
Os05g0107700 is a recessive gene associated with resistance to rice bacterial leaf blight.
+
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os05g0107700''''' '''<=>''' ''''' xa-5, xa5,OsXA5'''''
  
 +
===Function===
 +
* The gene ''xa5'' provides racespecific resistance to ''X. oryzae'' pv. ''oryzae'', and encodes the small subunit of transcription factor ''IIA(TFIIAγ)''.
 +
* This recessive gene provides race-specific resistance to ''X. oryzae'' pv. ''oryzae'', and is structurally unlike the more than 40 plant R genes previously cloned.
 +
* ''xa5'' is inherited in a completely recessive manner and the susceptible allele ''Xa5'' is fully dominant.
 +
* ''xa5''-mediated recessive resistance is the result of restricted bacterial movement, but not restricted multiplication.
  
===Function===
+
===Evolution===
Please input function information here.
 
  
===Expression===
+
* ''xa5'' is a recessive, race-specific ''R'' gene that provides immunity to races of ''Xanthomonas oryzae'' pv. ''oryzae'' expressing ''avrxa5'', the cognate avirulence gene to ''xa5''. ''X. oryzae'' pv. ''oryzae'' causes rice bacterial blight, a severe disease in South and Southeast Asia. ''Avrxa5'' is likely to be a member of the ''AvrBs3'' family of proteins (Bai et al., 2000; Hopkins et al., 1992), which are usually characterized by nuclear localization signals and transcriptional activation domains (Bonas and Lahaye, 2002).
Please input expression information here.
 
  
===Evolution===
+
* ''xa5'' is a naturally occurring mutation that is most commonly found in the Aus-Boro group of rice (''Oryzae sativa L.'') varieties from the Bangladeshi region of Asia (Garris et al., 2003).There are over 20 resistance genes to ''X. oryzae'' pv. ''oryzae'', three of which have been cloned (''Xa21,Xa1,'' and ''Xa26'') and fall into one of the five typical ''R'' gene classes (Song et al., 1995; Sun et al., 2004; Yoshimura et al., 1998). ''Xa21'' and ''Xa26'' both encode NBS-LRR proteins containing a kinase domain, while ''Xa1'' encodes a member of the NBS-LRR class.
Please input evolution information here.
 
  
You can also add sub-section(s) at will.
+
* ''xa5'' does not resemble either of the two cloned recessive resistance genes in plants, ''mlo'' or ''RRS1-R''. In contrast to ''xa5'', resistance governed by barley mlois not race-specific (Buschges et al., 1997). Mutations in ''Mlo'' result in immunity to nearly all isolates of the fungal pathogen ''Erysiphe graminis'' f. sp. hordei. The ''RRS1-R'' gene from ''Arabidopsis'' provides resistance to several strains of ''Ralstonia solanacearum'' and encodes an NBSLRR protein with a WRKY motif characteristic of some plant transcription factors (Deslandes et al., 2002). The ''RRS1-R'' gene product physically interacts with its cognate protein PopP2 (Deslandes et al., 2003). Unlike ''xa5'', ''RRS1-R'' shares many characteristics with dominant ''R'' genes (Deslandes et al., 2003). For example, while genetically defined as recessive, ''RRS1-R'' behaves as a dominant gene in transgenic plants and is a member of the NBS-LRR ''R'' gene class.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Plant Genome Mapping Laboratory, University of Georgia,Riverbend Research Laboratory, Room 162, Athens,GA 30602, USA
+
* Plant Genome Mapping Laboratory, University of Georgia,Riverbend Research Laboratory, Room 162, Athens,GA 30602, USA
  
Institute of Genomic Diversity, Plant Breeding Department,130 Biotechnology Building, Cornell University, USA
+
* Institute of Genomic Diversity, Plant Breeding Department,130 Biotechnology Building, Cornell University, USA
  
CIAT - International Center for Tropical Agriculture,A. A. 6713, Cali, Colombia, South America
+
* CIAT - International Center for Tropical Agriculture,A. A. 6713, Cali, Colombia, South America
  
Central Rice Research Institute (CRRI), Cuttack 753 006, India
+
* Central Rice Research Institute (CRRI), Cuttack 753 006, India
  
International Rice Research Institute (IRRI), Los Banos, Philippines
+
* International Rice Research Institute (IRRI), Los Banos, Philippines
  
College of Life Sciences, Wuhan University,Wuhan, 430072, P.R. China
+
* College of Life Sciences, Wuhan University,Wuhan, 430072, P.R. China
  
Department of Plant Breeding and Genetics, 240 Emerson Hall, Cornell University, Ithaca NY 14853, USA
+
* Department of Plant Breeding and Genetics, 240 Emerson Hall, Cornell University, Ithaca NY 14853, USA
  
 
==References==
 
==References==
Please input cited references here.
+
* (1)A. S. Iyer-Pascuzzi;H. Jiang;L. Huang;and S. R. McCouch. Genetic and Functional Characterization of the Rice Bacterial Blight Disease Resistance Gene xa5. Phytopathology, 2008, 98(3): 289-295
 +
 
 +
* (2)Anjali S. Iyer;and Susan R. McCouch. The Rice Bacterial Blight Resistance Gene xa5 Encodes a Novel Form of Disease Resistance. Molecular Plant-Microbe Interactions, 2004, 17(12): 1348-1354
 +
 
 +
* (3)Matthew W. Blair;Amanda J. Garris;Anjali S. Iyer;Brad Chapman;Stephen Kresovich;Susan R. McCouch. High resolution genetic mapping and candidate gene identification at the xa5 locus for bacterial blight resistance in rice (Oryza sativa L.). Theoretical and Applied Genetics, 2003, 107(1): 62-73
 +
 
 +
* (4)Marella Lalitha Shanti; M. L. C. George; C. M. Vera Cruz; M. A. Bernardo; R. J. Nelson; H. Leung; J. N. Reddy and R. Sridhar.  Identification of Resistance Genes Effective Against Rice Bacterial Blight Pathogen in Eastern India. Phytopathology, 2001, 85(5): 506-512
 +
 
 +
* (5)D. Yang;A. Sanchez;G. S. Khush;Y. Zhu and N. Huang. Construction of a BAC contig containing the xa5 locus in rice. Theoretical and Applied Genetics, 1998, 97(7): 1120-1124
 +
 
 +
* (6)M. W. Blair and S. R. McCouch. Microsatellite and sequence-tagged site markers diagnostic for the rice bacterial leaf blight resistance gene xa-5. Theoretical and Applied Genetics, 1997, 95(1-2): 174-184
 +
 
 +
* (7)V. Petpisit;Gurdev S. Khush and H. E. Kauffman. Inheritance of Resistance to Bacterial Blight in Rice. Crop Science, 1977, 17(4): 551-554
 +
 
 +
* (8)Identification and gene prediction of a 24 kbregion containing xa5,a recessive bacterial blight resistance gene in rice(Oryza sativa L.)[J]. Chinese Science Bulletin,2003,24:2725-2729.
 +
 
 +
* (9)Comparative physical mapping of rice BAC clones linked to resistance genes Glh,Bph-3 and xa-5 in Oryza sativa L. and O. granulata Nees et Arn.ex Watt.[J]. Chinese Science Bulletin,2004,06:591-596.
 +
 
 +
* (10)Virulence of Xanthomonas oryzae pv. oryzae on Rice Near-Isogenic Lines with Single Resistance Gene and Pyramiding Lines in China[J]. Agricultural Sciences in China,2004,10:45-50.
 +
 
 +
* (11)Application of Functional Markers to Identify Genes for Bacterial Blight Resistance in Oryza rufipogon[J]. Rice Science,2010,01:73-76.
 +
 
 +
* (12)Identification of an avirulence gene,avrxa5,from the rice pathogen Xanthomonas oryzae pv.oryzae[J]. Science China(Life Sciences),2010,12:1440-1449.
 +
 
 +
* (13)Evaluation of the Pathotypes of Xanthomonas oryzae pv. oryzae and Preliminary Analysis of the Resistant Reactions of Main Japonica Rice in the Yunnan Plateau, China[J]. Agricultural Sciences in China,2006,04:299-306.
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os05g0107700|
 
Description = Transcription factor IIA small subunit (Transcription factor IIA gamma subunit)|
 
Version = NM_001060961.1 GI:115461652 GeneID:4337575|
 
Length = 6227 bp|
 
Definition = Oryza sativa Japonica Group Os05g0107700, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 5|Chromosome 5]]|
 
AP = Chromosome 5:415085..421311|
 
CDS = 415426..415554,415649..415699,420795..420935|
 
GCID = <gbrowseImage1>
 
name=NC_008398:415085..421311
 
source=RiceChromosome05
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008398:415085..421311
 
source=RiceChromosome05
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggccaccttcgagctctaccggaggtccaccattggcatgtgcctcactgagacgctcgacgagatggtctccagcggcaccctcagcccggagctcgccattcaagttcttgtccagtttgataagtctatgacggaagccttggagaaccaagtcaagagcaaggtttctatcaagggccacctgcacacttacaggttctgtgacaatgtatggacattcatcttgactgaagcatcattcaagaacgaggagactacagaacaagttggcaaggtgaagattgtggcctgtgattccaaactactcagccaataa</cdnaseq>|
 
AA = <aaseq>MATFELYRRSTIGMCLTETLDEMVSSGTLSPELAIQVLVQFDKS                    MTEALENQVKSKVSIKGHLHTYRFCDNVWTFILTEASFKNEETTEQVGKVKIVACDSK                    LLSQ</aaseq>|
 
DNA = <dnaseqindica>342..470#565..615#5711..5851#gtctcctccgctcctcctctccttgcgccaacaagccgactcgcgatctccatcgggcaagaagagcagagcagagcaggggaggggatcctgcaggtgaccatcctctttctttctttctttctttctctgaattcatctctctctctcccaccgggactctctacttttgtctggaatttgctcgcgttcgttcgttaaccctagcttctcttctcttctcttctagatctggaagaagctcttaatttcagagccttaacctctcttaatactacaagtaacaacagttttgttgtttgttccccccaccccaaaaagtttaggcgcacgcatcgcccatggccaccttcgagctctaccggaggtccaccattggcatgtgcctcactgagacgctcgacgagatggtctccagcggcaccctcagcccggagctcgccattcaagttcttgtccagtttgataaggtatctactttaccatatctccttccacctattactatctatactattgaaaaattcgactcctcattttgtttgttatcatctatgtgattagtctatgacggaagccttggagaaccaagtcaagagcaaggtttctatcaaggtatctgctcttatcacggagttgccatgttgctgttcctacccccccaaaaaaaaccaagccttacttgtgctgtgcataactttaatctctatctgtttcgagcctactcattatttatgcttgagaactcatatgcgcttgtgatgtaatttctccagtgctagaattgatacacttggttgtggattcagcgttgccattcgattttcttttccgtacacaccttgctaaaggaatcaagtctaaaatttgtttcttgcatatattatattattattattattcataaaggaatccattcacgttcgacacgtacctgtcctgtgtacgctgctctgagttctgagggatattgcacaaactttatagtaatgagtaagcgagtaacagaattaagacctatcagcaacataatacacgggcataaccagacaaatcttgcacttatcacatatatgcttttattttttcggctgtacaagcatatttccacttatcttattttgcaacacatcaagtactccttgagttgctcagattccaagctgctcatctgtgtttggccccaaaaaaaaagaaaagaaagaaaaaccttttattggataaacaagcctgagaaatgtcaagatcttttcttgccagcataatcctcaccaaaatgaaattatgaataaagattagtgtcattctttctgatacccatgtagtttgttattctatggcatgatagagattcttttttgtttgtgaattgggggtaatcacagaaatggactgatatttttgcccaacaatgggtgacttgtttacgtatcttactgtaatccgctttactcctggccccttgccccttttttataaatggaagtcaaaagtatgcaaaatataggcaactcgcacattacaatagcctcagaccctaactaccacatcgcaaccatgtgcgagttaggaatgccacacccggatgtgtgtcctctatgcgatcaggaggagactatacagcatattttggtgacttgtgttttttcctggcaagtatggtttttaatcttccaaatggttggatgggcgctgcagcactgcaaccatcaatgaatcgcttgtctagctggtggttcaaaacagttaaggatactcctaaagaggtaaagaaagggctgaactctttgattatcctagtggcatgggaaatatggaagcatcgcaatgattgtgtcttcaatggtgcctccccgagaatctcggctgttttgcatgcagtggctagagagagttctctttggtgtactgctggagcaaaggcactcctcgaaattctgtgtgggttgctccccctggacggctagtttctcctagggggtgtttcggttgcacgtcgcgttccgtgatgtttttttgtgtttctgtaggggtcctttgggtcactcggttgtacaatttctcttcttaatgaaatgaatcgcagtcctcctgtggtttcgagaaaaaaaaactcacacattgcaatattgcccatattaaaacactgatttttccccataaaccaaaacaagaaataaagtaactaagtgaccctggtgtgtacatgtttattagaacttctttatctgcaatattgtgcaagagaaacaagccgcaaacagcgttggagctcaataacaaaccagtaatgatgctagaaaccgtaccaaacataagacggtactctgctagaaaccttttttttttgtgccaagaagcgacttgaccactcaacatctcaatttcccttctgatcacaagcaatctagggctcatcgctgggttcgtacgataatcacacttccctgttctccattcttgtcatagttcagtgctctgctcctctaactgtgcttgtagtatcaatcagtcctctgggccattcgtagacgcaacaggcagctcaccaagttcgggtgaatcgttttgtcgtgtttattcttgtcccattagtcactagatagttcagcactgttcttgttattctattgatgcatttgtatatgactcattttcacgaaaggtgcatcaagagcattatattactgtagctatgtagttgttatcggtgagctttgctccatgctaaaagagttgggctaaatctatagcatttaagaattagttatagctggaaagatcatgtttgtcttgtagattcgactacctgatagcagctatccacctggatgatgaacagatctgtccatgacaacctgctgggctatggtgcatgcatgcacccatgtgataagtatgtaaaacgctatcctagatatagttttgcaagaattgatctctattgctaccggagactagaaaggtgttatggattggctagggcaagggtccgaagaccgggggatatagcactcgccctctaatagcagaggcagggcttctccctgctgagctaaaagaggctatgaggcttagggctaactttagagattcattgattgattgataagagtacatggggtcactttatatatagggaggacaggcttgacatccaaggaactaatctctagtactacagaaaccagtccaatctctatctctaactttctaataaacctcatctctttcctaattagataatctcctacctatatatgagtaattcgtaatttatgatgcctaaactgctgcatgggcctggtccatgcccataacactacacccctcgcggacagatagtcttcgagcactagcagatatcttcttggaaagaacttcaatggtagcagtcggcaaatcatcaaagcgaagtttgatatttttcttgagttctggccaagtttgaattccgtaggctcgctcaatcaactcataccacattgcggcaaacctggtccggtggcttgatgcaatccaccacttctcttcctccataaattcgctgctcaacaaagaactgctcaatactctccaaccaaatttgcggatcatcctcaccattgaacgttgggagaggttcaaggtggcgaaatctccacatccaattgaaatccccgctgcacgccatcgagggtggagcatcagttggctctgataccaaatgttatggattggctagggtaagggtgcaaagactgggggatagggcactcgccctctaatagcagaggcagggcttcttcctgctgagctaagaggctctgaggcctagggctagctttagagattcattgattgattgattgataatgcagtacgtgggacccctttatatatagggaggacaggcttgatatccaaggaactaatatctagtaccatagaaaccagtgcaatctctatctctaactttctaatagacctcatctctttcctaactagataatctcctacctttatatgagtaattcctaatttataatgcctaaactgctgcatgggcctggtccatgcccataacaaaaggaggtaaacgctatcttatagcttctaaatacggcacacctttatcatccatttctagttttggcttatggaaaaatcttcagttaaagcatttatgatattacaaaattgcagatgacgttttgtcggcatctgaactctcgtgaatctgctgcttgccccttcttagttgttccttaagttgtttcggcctttccaatttagcagtacacttaatcctcatgatccaaccatggccatcaattttcaattttcaactctgagcactctcgaccaatctcccatcagctgggacctattcagctgtctaagacatacattcacaaaggagattgcatgttctgattttcatttttacttgtaaaatgtaatgtttgcatagccattttgtatgtttagcctgaaaatggttgaagcatagttaccagttcatttgttttggtgttttacctgataatgtccagtgtatgaagacatgcgataattgataaattcatatatccggccactcttttacaactgtcactgtgtgggtttaagaaatccctcttttgacaaaccgcagttctctttttcttttccaaagaattgttaatcccacactgaattgctgtattaggaagggatcacctctacaatatgtcatttatgatatgtggtgttgagatgttacgtgttctgttttatttttgacgaaaatgcaggagaactggcattccattaaccattagctaagaaatgtacatggttttatcagtcataaactggacttactattttagaatcatgaactagagttttgctaatggaaattttaccattttaaaaatcatgaactggagtttgaattaatctctgttttatttatttttgagtaaatttcataaaactacatatactttgcatgatctatcacaaaactatagatttaagaacttatttcacaaaactacaaatttaatgtcttcgtttatcacaaaactacaggtattttacacaatatatcacaaaactacagatttaagaacttgtttcacaaaactacagatttaatatcttcatttatcataaaactacaggtttagtgtcttcattatcacaaaactacaggttttagcattgtcaaaacctgtagttttgtgataatggagacactaaatttgtagttttgtgataaatgaagacactaaatgtgtagtcctatgataaacgaatacactaattctatagttttgtgaaacaagttcttaaatctgtagttttgtgatagattgtacaaagtacctgtagttttgtgataaacgggcatactaaatctgtagttttgtgaaacaagctcttaaatctgtagttttgtgataaattgtgcaaaatacatgtagttttgtgaaatttactctttatttttctaacttgctatcctgctccagaaattttccattctagttacatgagtttaagcctcttgtcattttggacgcaatgtcgaacagacctgtatttgatggattttttttgtttatttaagaataagttctctggtacagcttagatacgatggatgattgactaactttttgagcctgtatttcagatattttgtagctgggctgtttactgatgcatgttcttttctcagggccacctgcacacttacaggttctgtgacaatgtatggacattcatcttgactgaagcatcattcaagaacgaggagactacagaacaagttggcaaggtgaagattgtggcctgtgattccaaactactcagccaataaattgataactgcgaggtcagggtttgcctggtatttgttagtctcttctgctagacctggctccgcctgaagtgtactgtaccaccacattgtttgtttcataatcaatgtgtgtcaatacaatcgtatgtgctaccagagtatatcacagcagcaactgttttaatttgtatgcttatgtaattgttatgctactgctgtgttgataatgtgatataaatgactaaacgatgagtagtagaaattgtgcggagtcaccctcccccttcctcatttctgaaccctttggttctgtgtgactctttgtatgtaacatgaacaaatacctcctttcccgtcttttttttggatcctatgttaatggtacctttacatt</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001060961.1 RefSeq:Os05g0107700]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 15:18, 6 May 2017

The rice Os05g0107700 was reported as 2003 in 2003 by researchers from USA.

Annotated Information

Gene Symbol

  • Os05g0107700 <=> xa-5, xa5,OsXA5

Function

  • The gene xa5 provides racespecific resistance to X. oryzae pv. oryzae, and encodes the small subunit of transcription factor IIA(TFIIAγ).
  • This recessive gene provides race-specific resistance to X. oryzae pv. oryzae, and is structurally unlike the more than 40 plant R genes previously cloned.
  • xa5 is inherited in a completely recessive manner and the susceptible allele Xa5 is fully dominant.
  • xa5-mediated recessive resistance is the result of restricted bacterial movement, but not restricted multiplication.

Evolution

  • xa5 is a recessive, race-specific R gene that provides immunity to races of Xanthomonas oryzae pv. oryzae expressing avrxa5, the cognate avirulence gene to xa5. X. oryzae pv. oryzae causes rice bacterial blight, a severe disease in South and Southeast Asia. Avrxa5 is likely to be a member of the AvrBs3 family of proteins (Bai et al., 2000; Hopkins et al., 1992), which are usually characterized by nuclear localization signals and transcriptional activation domains (Bonas and Lahaye, 2002).
  • xa5 is a naturally occurring mutation that is most commonly found in the Aus-Boro group of rice (Oryzae sativa L.) varieties from the Bangladeshi region of Asia (Garris et al., 2003).There are over 20 resistance genes to X. oryzae pv. oryzae, three of which have been cloned (Xa21,Xa1, and Xa26) and fall into one of the five typical R gene classes (Song et al., 1995; Sun et al., 2004; Yoshimura et al., 1998). Xa21 and Xa26 both encode NBS-LRR proteins containing a kinase domain, while Xa1 encodes a member of the NBS-LRR class.
  • xa5 does not resemble either of the two cloned recessive resistance genes in plants, mlo or RRS1-R. In contrast to xa5, resistance governed by barley mlois not race-specific (Buschges et al., 1997). Mutations in Mlo result in immunity to nearly all isolates of the fungal pathogen Erysiphe graminis f. sp. hordei. The RRS1-R gene from Arabidopsis provides resistance to several strains of Ralstonia solanacearum and encodes an NBSLRR protein with a WRKY motif characteristic of some plant transcription factors (Deslandes et al., 2002). The RRS1-R gene product physically interacts with its cognate protein PopP2 (Deslandes et al., 2003). Unlike xa5, RRS1-R shares many characteristics with dominant R genes (Deslandes et al., 2003). For example, while genetically defined as recessive, RRS1-R behaves as a dominant gene in transgenic plants and is a member of the NBS-LRR R gene class.

Labs working on this gene

  • Plant Genome Mapping Laboratory, University of Georgia,Riverbend Research Laboratory, Room 162, Athens,GA 30602, USA
  • Institute of Genomic Diversity, Plant Breeding Department,130 Biotechnology Building, Cornell University, USA
  • CIAT - International Center for Tropical Agriculture,A. A. 6713, Cali, Colombia, South America
  • Central Rice Research Institute (CRRI), Cuttack 753 006, India
  • International Rice Research Institute (IRRI), Los Banos, Philippines
  • College of Life Sciences, Wuhan University,Wuhan, 430072, P.R. China
  • Department of Plant Breeding and Genetics, 240 Emerson Hall, Cornell University, Ithaca NY 14853, USA

References

  • (1)A. S. Iyer-Pascuzzi;H. Jiang;L. Huang;and S. R. McCouch. Genetic and Functional Characterization of the Rice Bacterial Blight Disease Resistance Gene xa5. Phytopathology, 2008, 98(3): 289-295
  • (2)Anjali S. Iyer;and Susan R. McCouch. The Rice Bacterial Blight Resistance Gene xa5 Encodes a Novel Form of Disease Resistance. Molecular Plant-Microbe Interactions, 2004, 17(12): 1348-1354
  • (3)Matthew W. Blair;Amanda J. Garris;Anjali S. Iyer;Brad Chapman;Stephen Kresovich;Susan R. McCouch. High resolution genetic mapping and candidate gene identification at the xa5 locus for bacterial blight resistance in rice (Oryza sativa L.). Theoretical and Applied Genetics, 2003, 107(1): 62-73
  • (4)Marella Lalitha Shanti; M. L. C. George; C. M. Vera Cruz; M. A. Bernardo; R. J. Nelson; H. Leung; J. N. Reddy and R. Sridhar. Identification of Resistance Genes Effective Against Rice Bacterial Blight Pathogen in Eastern India. Phytopathology, 2001, 85(5): 506-512
  • (5)D. Yang;A. Sanchez;G. S. Khush;Y. Zhu and N. Huang. Construction of a BAC contig containing the xa5 locus in rice. Theoretical and Applied Genetics, 1998, 97(7): 1120-1124
  • (6)M. W. Blair and S. R. McCouch. Microsatellite and sequence-tagged site markers diagnostic for the rice bacterial leaf blight resistance gene xa-5. Theoretical and Applied Genetics, 1997, 95(1-2): 174-184
  • (7)V. Petpisit;Gurdev S. Khush and H. E. Kauffman. Inheritance of Resistance to Bacterial Blight in Rice. Crop Science, 1977, 17(4): 551-554
  • (8)Identification and gene prediction of a 24 kbregion containing xa5,a recessive bacterial blight resistance gene in rice(Oryza sativa L.)[J]. Chinese Science Bulletin,2003,24:2725-2729.
  • (9)Comparative physical mapping of rice BAC clones linked to resistance genes Glh,Bph-3 and xa-5 in Oryza sativa L. and O. granulata Nees et Arn.ex Watt.[J]. Chinese Science Bulletin,2004,06:591-596.
  • (10)Virulence of Xanthomonas oryzae pv. oryzae on Rice Near-Isogenic Lines with Single Resistance Gene and Pyramiding Lines in China[J]. Agricultural Sciences in China,2004,10:45-50.
  • (11)Application of Functional Markers to Identify Genes for Bacterial Blight Resistance in Oryza rufipogon[J]. Rice Science,2010,01:73-76.
  • (12)Identification of an avirulence gene,avrxa5,from the rice pathogen Xanthomonas oryzae pv.oryzae[J]. Science China(Life Sciences),2010,12:1440-1449.
  • (13)Evaluation of the Pathotypes of Xanthomonas oryzae pv. oryzae and Preliminary Analysis of the Resistant Reactions of Main Japonica Rice in the Yunnan Plateau, China[J]. Agricultural Sciences in China,2006,04:299-306.

Structured Information