Difference between revisions of "Os05g0107700"

From RiceWiki
Jump to: navigation, search
(→‎References)
 
(5 intermediate revisions by 3 users not shown)
Line 1: Line 1:
−
''Os05g0107700'', named as ''xa5'', is a recessive gene associated with resistance to rice bacterial leaf blight.
+
The rice '''''Os05g0107700''''' was reported as '''''2003''''' in 2003 by researchers from USA.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os05g0107700''''' '''<=>''' ''''' xa-5, xa5,OsXA5'''''
 +
 
===Function===
 
===Function===
−
The gene ''xa5'' provides racespecific resistance to ''X. oryzae'' pv. ''oryzae'', and encodes the small subunit of transcription factor ''IIA(TFIIAγ)''. This recessive gene provides race-specific resistance to ''X. oryzae'' pv. ''oryzae'', and is structurally unlike the more than 40 plant R genes previously cloned. ''xa5'' is inherited in a completely recessive manner and the susceptible allele ''Xa5'' is fully dominant. ''xa5''-mediated recessive resistance is the result of restricted bacterial movement, but not restricted multiplication.
+
* The gene ''xa5'' provides racespecific resistance to ''X. oryzae'' pv. ''oryzae'', and encodes the small subunit of transcription factor ''IIA(TFIIAγ)''.  
 +
* This recessive gene provides race-specific resistance to ''X. oryzae'' pv. ''oryzae'', and is structurally unlike the more than 40 plant R genes previously cloned.
 +
* ''xa5'' is inherited in a completely recessive manner and the susceptible allele ''Xa5'' is fully dominant.  
 +
* ''xa5''-mediated recessive resistance is the result of restricted bacterial movement, but not restricted multiplication.
  
−
Plants with lesions less than 4 cm are resistant, while those greater than 4 cm are susceptible. The susceptible ''indica'' isoline IR24 and the resistant ''indica'' isoline IRBB5 were referred to as IS and IR respectively. No significant difference in lesion length between IS and heterozygous F2s 14 dpi was observed. In addition, bacterial populations over time in heterozygous plants were similar to those in homozygous susceptible IS individuals. These results demonstrate that the ''Xa5'' allele is not dose-dependent in the ''indica'' IR24 background.
+
===Evolution===
  
−
Although ''X. oryzae'' pv. ''oryzae'' multiplied extensively in resistant IR lines, lesion lengths were consistently less than 4 cm. Genetic background may play a role in resistance mediated by specific ''Xa'' genes. ''X. oryzae'' pv. ''oryzae'' -''xa5'' dynamics appear to differ in the indica and japonica NILs. Bacterial movement is restricted in both ''indica'' and ''japonica'' resistant plants. In both ''indica'' and ''japonica'' NILs, ''X. oryzae'' pv. '''oryzae''' movement down the leaf was dramatically faster in susceptible than in resistant leaves. Movement in resistant leaves appeared to be more restricted in JR than IR.
+
* ''xa5'' is a recessive, race-specific ''R'' gene that provides immunity to races of ''Xanthomonas oryzae'' pv. ''oryzae'' expressing ''avrxa5'', the cognate avirulence gene to ''xa5''. ''X. oryzae'' pv. ''oryzae'' causes rice bacterial blight, a severe disease in South and Southeast Asia. ''Avrxa5'' is likely to be a member of the ''AvrBs3'' family of proteins (Bai et al., 2000; Hopkins et al., 1992), which are usually characterized by nuclear localization signals and transcriptional activation domains (Bonas and Lahaye, 2002).
  
−
No significant difference between untransformed susceptible ''japonicas(JS)'' and ''Xa5'' transformed previously resistant ''japonicas (JR::Xa5)'' was observed. In the ''japonica'' subspecies as in the ''indica'', ''xa5'' operates as a recessive gene and genetic background does not affect its gene action. Since the transgenic ''JR::Xa5'' plants contain two copies of the recessive resistant ''xa5'' allele, one allele of ''Xa5'' is sufficient for disease even in plants with two copies of ''xa5''. Additional insertions of ''Xa5'' do not result in increased disease severity in previously resistant genotypes，suggesting that ''Xa5'' may be a susceptibility allele（Iyer-Pascuzzi et al., 2008).
+
* ''xa5'' is a naturally occurring mutation that is most commonly found in the Aus-Boro group of rice (''Oryzae sativa L.'') varieties from the Bangladeshi region of Asia (Garris et al., 2003).There are over 20 resistance genes to ''X. oryzae'' pv. ''oryzae'', three of which have been cloned (''Xa21,Xa1,'' and ''Xa26'') and fall into one of the five typical ''R'' gene classes (Song et al., 1995; Sun et al., 2004; Yoshimura et al., 1998). ''Xa21'' and ''Xa26'' both encode NBS-LRR proteins containing a kinase domain, while ''Xa1'' encodes a member of the NBS-LRR class.
  
−
Using several key experimental observations, we have shown that xa5 encodes TFIIAγ. First, a collection of individuals recombinant between resistant and susceptible parents allowed us to narrow the region to an approximately 8.1-kb interval containing the gamma subunit of TFIIA. This region was located
+
* ''xa5'' does not resemble either of the two cloned recessive resistance genes in plants, ''mlo'' or ''RRS1-R''. In contrast to ''xa5'', resistance governed by barley mlois not race-specific (Buschges et al., 1997). Mutations in ''Mlo'' result in immunity to nearly all isolates of the fungal pathogen ''Erysiphe graminis'' f. sp. hordei. The ''RRS1-R'' gene from ''Arabidopsis'' provides resistance to several strains of ''Ralstonia solanacearum'' and encodes an NBSLRR protein with a WRKY motif characteristic of some plant transcription factors (Deslandes et al., 2002). The ''RRS1-R'' gene product physically interacts with its cognate protein PopP2 (Deslandes et al., 2003). Unlike ''xa5'', ''RRS1-R'' shares many characteristics with dominant ''R'' genes (Deslandes et al., 2003). For example, while genetically defined as recessive, ''RRS1-R'' behaves as a dominant gene in transgenic plants and is a member of the NBS-LRR ''R'' gene class.
−
1.5 kb upstream of the gene encoding the hypothetical protein Q94HL4. Sequencing and expression analysis eliminated Q94HL4 from further consideration but identified a single amino acid change within the coding region of TFIIAγ that distinguished the resistant and susceptible isolines and would
 
−
not affect the expression TFIIAγ. Third, sequencing of 27 resistant and nine susceptible cultivars in the Aus-Boro group demonstrated a perfect association between the haplotype of E39 and resistance to race 2 of X. oryzae pv. oryzae. Together, these lines of evidence demonstrate that TFIIAγ encodes the
 
−
xa5 resistance gene.
 
  
−
TFIIA is one of a set of general transcription factors required for transcription by RNA polymerase II (Orphanides et al. 1996). The functional molecule is composed of two subunits in yeast and three in plants and humans. TFIIA is essential to cell growth and has been shown to have several roles in
+
==Labs working on this gene==
−
transcription, including stimulation and stabilization of the interaction between the TATA-box binding protein and the general
+
* Plant Genome Mapping Laboratory, University of Georgia,Riverbend Research Laboratory, Room 162, Athens,GA 30602, USA
−
transcription factor TFIID, promoter selection, gene-specific regulation, and activator-dependent transcription (Hampsey et al. 1998; Orphanides et al. 1996).
 
  
 +
* Institute of Genomic Diversity, Plant Breeding Department,130 Biotechnology Building, Cornell University, USA
  
 +
* CIAT - International Center for Tropical Agriculture,A. A. 6713, Cali, Colombia, South America
  
−
===Expression===
+
* Central Rice Research Institute (CRRI), Cuttack 753 006, India
−
The rice ''xa5'' gene for disease resistance to ''Xanthomonas oryzae'' pv. ''oryzae'' has been positionally cloned and encodes the gamma subunit of transcription factor IIA ''(TFIIAγ)''. ''TFIIAγ''is a general eukaryotic transcription factor with no previously known role in disease resistance. ''xa5'' is unusual in that it is recessive and does not conform to one of the typical resistance gene structural classes. Sequencing of ''TFIIAγ'' in resistant and susceptible isolines revealed two nucleotide substitutions resulting in an amino acid change between resistant and susceptible cultivars. This association was conserved across 27 resistant and nine susceptible rice lines in the Aus-Boro group.
 
  
−
Positional cloning identifies ''xa5'' in an 8.1-kb region containing ''TFIIAγ'' in the subtelomeric region of chromosome 5. The start codon, splice junctions, and 3′UTR of the ''TFIIγ''gene were defined by aligning a Nipponbare ''TFIIAγ'' cDNA (GI 32975200) to the IR24 (susceptible) BAC. This identified two nucleotide substitutions resulting in an amino acid substitution from valine to glutamic acid at position 39 in the resistant cultivar, a significant change from a hydrophobic to hydrophilic amino acid. Examination of the structure of ''TFIIAγ'' further showed that the variable amino acid at position 39 resided in a solvent-exposed surface, suggesting that it may play a role in protein-protein interactions (Bleichenbacher et al., 2003).This single amino acid change in ''TFIIAγ'' is consistent with the stable expression of this gene in both susceptible and resistant plants and leads to the hypothesis that it functions both as general transcription factor and as ''xa5''.
+
* International Rice Research Institute (IRRI), Los Banos, Philippines
  
−
A single resistant haplotype conserved across all 27 resistant lines was found. There were two haplotypes among the 11 susceptible accessions, each of which carried nucleotides that would result in a valine at position 39. The ''japonica'' Nipponbare as well as four of the Aus-Boro lines contained the same susceptible haplotype as IR24, while five Aus-Boro lines had a silent mutation within the coding region（Iyer and McCouch, 2004）.
+
* College of Life Sciences, Wuhan University,Wuhan, 430072, P.R. China
  
−
Xa5,this novel disease R gene provides adult plant resistance and encodes the gamma subunit of transcription factor IIA (TFIIAγ), one of several general transcription factors responsible for accurate transcription by RNA polymerase II.
+
* Department of Plant Breeding and Genetics, 240 Emerson Hall, Cornell University, Ithaca NY 14853, USA
  
−
Previous results had narrowed xa5 to an approximately 100-kb segment in the subtelomeric region of chromosome 5.
+
==References==
 +
* (1)A. S. Iyer-Pascuzzi;H. Jiang;L. Huang;and S. R. McCouch. Genetic and Functional Characterization of the Rice Bacterial Blight Disease Resistance Gene xa5. Phytopathology, 2008, 98(3): 289-295
  
−
===Evolution===
+
* (2)Anjali S. Iyer;and Susan R. McCouch. The Rice Bacterial Blight Resistance Gene xa5 Encodes a Novel Form of Disease Resistance. Molecular Plant-Microbe Interactions, 2004, 17(12): 1348-1354
  
−
''xa5'' is a recessive, race-specific ''R'' gene that provides immunity to races of ''Xanthomonas oryzae'' pv. ''oryzae'' expressing ''avrxa5'', the cognate avirulence gene to ''xa5''. ''X. oryzae'' pv. ''oryzae'' causes rice bacterial blight, a severe disease in South and Southeast Asia. ''Avrxa5'' is likely to be a member of the ''AvrBs3'' family of proteins (Bai et al., 2000; Hopkins et al., 1992), which are usually characterized by nuclear localization signals and transcriptional activation domains (Bonas and Lahaye, 2002).
+
* (3)Matthew W. Blair;Amanda J. Garris;Anjali S. Iyer;Brad Chapman;Stephen Kresovich;Susan R. McCouch. High resolution genetic mapping and candidate gene identification at the xa5 locus for bacterial blight resistance in rice (Oryza sativa L.). Theoretical and Applied Genetics, 2003, 107(1): 62-73
  
−
''xa5'' is a naturally occurring mutation that is most commonly found in the Aus-Boro group of rice (''Oryzae sativa L.'') varieties from the Bangladeshi region of Asia (Garris et al., 2003).There are over 20 resistance genes to ''X. oryzae'' pv. ''oryzae'', three of which have been cloned (''Xa21,Xa1,'' and ''Xa26'') and fall into one of the five typical ''R'' gene classes (Song et al., 1995; Sun et al., 2004; Yoshimura et al., 1998). ''Xa21'' and ''Xa26'' both encode NBS-LRR proteins containing a kinase domain, while ''Xa1'' encodes a member of the NBS-LRR class.
+
* (4)Marella Lalitha Shanti; M. L. C. George; C. M. Vera Cruz; M. A. Bernardo; R. J. Nelson; H. Leung; J. N. Reddy and R. Sridhar.  Identification of Resistance Genes Effective Against Rice Bacterial Blight Pathogen in Eastern India. Phytopathology, 2001, 85(5): 506-512
  
−
''xa5'' does not resemble either of the two cloned recessive resistance genes in plants, ''mlo'' or ''RRS1-R''. In contrast to ''xa5'', resistance governed by barley mlois not race-specific (Buschges et al., 1997). Mutations in ''Mlo'' result in immunity to nearly all isolates of the fungal pathogen ''Erysiphe graminis'' f. sp. hordei. The ''RRS1-R'' gene from ''Arabidopsis'' provides resistance to several strains of ''Ralstonia solanacearum'' and encodes an NBSLRR protein with a WRKY motif characteristic of some plant transcription factors (Deslandes et al., 2002). The ''RRS1-R'' gene product physically interacts with its cognate protein PopP2 (Deslandes et al., 2003). Unlike ''xa5'', ''RRS1-R'' shares many characteristics with dominant ''R'' genes (Deslandes et al., 2003). For example, while genetically defined as recessive, ''RRS1-R'' behaves as a dominant gene in transgenic plants and is a member of the NBS-LRR ''R'' gene class.
+
* (5)D. Yang;A. Sanchez;G. S. Khush;Y. Zhu and N. Huang. Construction of a BAC contig containing the xa5 locus in rice. Theoretical and Applied Genetics, 1998, 97(7): 1120-1124
  
−
==Labs working on this gene==
+
* (6)M. W. Blair and S. R. McCouch. Microsatellite and sequence-tagged site markers diagnostic for the rice bacterial leaf blight resistance gene xa-5. Theoretical and Applied Genetics, 1997, 95(1-2): 174-184
−
Plant Genome Mapping Laboratory, University of Georgia,Riverbend Research Laboratory, Room 162, Athens,GA 30602, USA
 
  
−
Institute of Genomic Diversity, Plant Breeding Department,130 Biotechnology Building, Cornell University, USA
+
* (7)V. Petpisit;Gurdev S. Khush and H. E. Kauffman. Inheritance of Resistance to Bacterial Blight in Rice. Crop Science, 1977, 17(4): 551-554
−
 
 
−
CIAT - International Center for Tropical Agriculture,A. A. 6713, Cali, Colombia, South America
 
−
 
 
−
Central Rice Research Institute (CRRI), Cuttack 753 006, India
 
−
 
 
−
International Rice Research Institute (IRRI), Los Banos, Philippines
 
−
 
 
−
College of Life Sciences, Wuhan University,Wuhan, 430072, P.R. China
 
−
 
 
−
Department of Plant Breeding and Genetics, 240 Emerson Hall, Cornell University, Ithaca NY 14853, USA
 
−
 
 
−
==References==
 
−
(1)A. S. Iyer-Pascuzzi;H. Jiang;L. Huang;and S. R. McCouch. Genetic and Functional Characterization of the Rice Bacterial Blight Disease Resistance Gene xa5. Phytopathology, 2008, 98(3): 289-295
 
  
−
(2)Anjali S. Iyer;and Susan R. McCouch. The Rice Bacterial Blight Resistance Gene xa5 Encodes a Novel Form of Disease Resistance. Molecular Plant-Microbe Interactions, 2004, 17(12): 1348-1354
+
* (8)Identification and gene prediction of a 24 kbregion containing xa5,a recessive bacterial blight resistance gene in rice(Oryza sativa L.)[J]. Chinese Science Bulletin,2003,24:2725-2729.
  
−
(3)Matthew W. Blair;Amanda J. Garris;Anjali S. Iyer;Brad Chapman;Stephen Kresovich;Susan R. McCouch. High resolution genetic mapping and candidate gene identification at the xa5 locus for bacterial blight resistance in rice (Oryza sativa L.). Theoretical and Applied Genetics, 2003, 107(1): 62-73
+
* (9)Comparative physical mapping of rice BAC clones linked to resistance genes Glh,Bph-3 and xa-5 in Oryza sativa L. and O. granulata Nees et Arn.ex Watt.[J]. Chinese Science Bulletin,2004,06:591-596.
  
−
(4)Marella Lalitha Shanti; M. L. C. George; C. M. Vera Cruz; M. A. Bernardo; R. J. Nelson; H. Leung; J. N. Reddy and R. Sridhar.  Identification of Resistance Genes Effective Against Rice Bacterial Blight Pathogen in Eastern India. Phytopathology, 2001, 85(5): 506-512
+
* (10)Virulence of Xanthomonas oryzae pv. oryzae on Rice Near-Isogenic Lines with Single Resistance Gene and Pyramiding Lines in China[J]. Agricultural Sciences in China,2004,10:45-50.
  
−
(5)D. Yang;A. Sanchez;G. S. Khush;Y. Zhu and N. Huang. Construction of a BAC contig containing the xa5 locus in rice. Theoretical and Applied Genetics, 1998, 97(7): 1120-1124
+
* (11)Application of Functional Markers to Identify Genes for Bacterial Blight Resistance in Oryza rufipogon[J]. Rice Science,2010,01:73-76.
  
−
(6)M. W. Blair and S. R. McCouch. Microsatellite and sequence-tagged site markers diagnostic for the rice bacterial leaf blight resistance gene xa-5. Theoretical and Applied Genetics, 1997, 95(1-2): 174-184
+
* (12)Identification of an avirulence gene,avrxa5,from the rice pathogen Xanthomonas oryzae pv.oryzae[J]. Science China(Life Sciences),2010,12:1440-1449.
  
−
(7)V. Petpisit;Gurdev S. Khush and H. E. Kauffman. Inheritance of Resistance to Bacterial Blight in Rice. Crop Science, 1977, 17(4): 551-554
+
* (13)Evaluation of the Pathotypes of Xanthomonas oryzae pv. oryzae and Preliminary Analysis of the Resistant Reactions of Main Japonica Rice in the Yunnan Plateau, China[J]. Agricultural Sciences in China,2006,04:299-306.
  
 
==Structured Information==
 
==Structured Information==
−
{{JaponicaGene|
 
−
GeneName = Os05g0107700|
 
−
Description = Transcription factor IIA small subunit (Transcription factor IIA gamma subunit)|
 
−
Version = NM_001060961.1 GI:115461652 GeneID:4337575|
 
−
Length = 6227 bp|
 
−
Definition = Oryza sativa Japonica Group Os05g0107700, complete gene.|
 
−
Source = Oryza sativa Japonica Group
 
  
−
  ORGANISM  Oryza sativa Japonica Group
 
−
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
−
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
−
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
−
|
 
−
Chromosome = [[:category:Japonica Chromosome 5|Chromosome 5]]|
 
−
AP = Chromosome 5:415085..421311|
 
−
CDS = 415426..415554,415649..415699,420795..420935|
 
−
GCID = <gbrowseImage1>
 
−
name=NC_008398:415085..421311
 
−
source=RiceChromosome05
 
−
preset=GeneLocation
 
−
</gbrowseImage1>|
 
−
GSID = <gbrowseImage2>
 
−
name=NC_008398:415085..421311
 
−
source=RiceChromosome05
 
−
preset=GeneLocation
 
−
</gbrowseImage2>|
 
−
CDNA = <cdnaseq>atggccaccttcgagctctaccggaggtccaccattggcatgtgcctcactgagacgctcgacgagatggtctccagcggcaccctcagcccggagctcgccattcaagttcttgtccagtttgataagtctatgacggaagccttggagaaccaagtcaagagcaaggtttctatcaagggccacctgcacacttacaggttctgtgacaatgtatggacattcatcttgactgaagcatcattcaagaacgaggagactacagaacaagttggcaaggtgaagattgtggcctgtgattccaaactactcagccaataa</cdnaseq>|
 
−
AA = <aaseq>MATFELYRRSTIGMCLTETLDEMVSSGTLSPELAIQVLVQFDKS                    MTEALENQVKSKVSIKGHLHTYRFCDNVWTFILTEASFKNEETTEQVGKVKIVACDSK                    LLSQ</aaseq>|
 
−
DNA = <dnaseqindica>342..470#565..615#5711..5851#gtctcctccgctcctcctctccttgcgccaacaagccgactcgcgatctccatcgggcaagaagagcagagcagagcaggggaggggatcctgcaggtgaccatcctctttctttctttctttctttctctgaattcatctctctctctcccaccgggactctctacttttgtctggaatttgctcgcgttcgttcgttaaccctagcttctcttctcttctcttctagatctggaagaagctcttaatttcagagccttaacctctcttaatactacaagtaacaacagttttgttgtttgttccccccaccccaaaaagtttaggcgcacgcatcgcccatggccaccttcgagctctaccggaggtccaccattggcatgtgcctcactgagacgctcgacgagatggtctccagcggcaccctcagcccggagctcgccattcaagttcttgtccagtttgataaggtatctactttaccatatctccttccacctattactatctatactattgaaaaattcgactcctcattttgtttgttatcatctatgtgattagtctatgacggaagccttggagaaccaagtcaagagcaaggtttctatcaaggtatctgctcttatcacggagttgccatgttgctgttcctacccccccaaaaaaaaccaagccttacttgtgctgtgcataactttaatctctatctgtttcgagcctactcattatttatgcttgagaactcatatgcgcttgtgatgtaatttctccagtgctagaattgatacacttggttgtggattcagcgttgccattcgattttcttttccgtacacaccttgctaaaggaatcaagtctaaaatttgtttcttgcatatattatattattattattattcataaaggaatccattcacgttcgacacgtacctgtcctgtgtacgctgctctgagttctgagggatattgcacaaactttatagtaatgagtaagcgagtaacagaattaagacctatcagcaacataatacacgggcataaccagacaaatcttgcacttatcacatatatgcttttattttttcggctgtacaagcatatttccacttatcttattttgcaacacatcaagtactccttgagttgctcagattccaagctgctcatctgtgtttggccccaaaaaaaaagaaaagaaagaaaaaccttttattggataaacaagcctgagaaatgtcaagatcttttcttgccagcataatcctcaccaaaatgaaattatgaataaagattagtgtcattctttctgatacccatgtagtttgttattctatggcatgatagagattcttttttgtttgtgaattgggggtaatcacagaaatggactgatatttttgcccaacaatgggtgacttgtttacgtatcttactgtaatccgctttactcctggccccttgccccttttttataaatggaagtcaaaagtatgcaaaatataggcaactcgcacattacaatagcctcagaccctaactaccacatcgcaaccatgtgcgagttaggaatgccacacccggatgtgtgtcctctatgcgatcaggaggagactatacagcatattttggtgacttgtgttttttcctggcaagtatggtttttaatcttccaaatggttggatgggcgctgcagcactgcaaccatcaatgaatcgcttgtctagctggtggttcaaaacagttaaggatactcctaaagaggtaaagaaagggctgaactctttgattatcctagtggcatgggaaatatggaagcatcgcaatgattgtgtcttcaatggtgcctccccgagaatctcggctgttttgcatgcagtggctagagagagttctctttggtgtactgctggagcaaaggcactcctcgaaattctgtgtgggttgctccccctggacggctagtttctcctagggggtgtttcggttgcacgtcgcgttccgtgatgtttttttgtgtttctgtaggggtcctttgggtcactcggttgtacaatttctcttcttaatgaaatgaatcgcagtcctcctgtggtttcgagaaaaaaaaactcacacattgcaatattgcccatattaaaacactgatttttccccataaaccaaaacaagaaataaagtaactaagtgaccctggtgtgtacatgtttattagaacttctttatctgcaatattgtgcaagagaaacaagccgcaaacagcgttggagctcaataacaaaccagtaatgatgctagaaaccgtaccaaacataagacggtactctgctagaaaccttttttttttgtgccaagaagcgacttgaccactcaacatctcaatttcccttctgatcacaagcaatctagggctcatcgctgggttcgtacgataatcacacttccctgttctccattcttgtcatagttcagtgctctgctcctctaactgtgcttgtagtatcaatcagtcctctgggccattcgtagacgcaacaggcagctcaccaagttcgggtgaatcgttttgtcgtgtttattcttgtcccattagtcactagatagttcagcactgttcttgttattctattgatgcatttgtatatgactcattttcacgaaaggtgcatcaagagcattatattactgtagctatgtagttgttatcggtgagctttgctccatgctaaaagagttgggctaaatctatagcatttaagaattagttatagctggaaagatcatgtttgtcttgtagattcgactacctgatagcagctatccacctggatgatgaacagatctgtccatgacaacctgctgggctatggtgcatgcatgcacccatgtgataagtatgtaaaacgctatcctagatatagttttgcaagaattgatctctattgctaccggagactagaaaggtgttatggattggctagggcaagggtccgaagaccgggggatatagcactcgccctctaatagcagaggcagggcttctccctgctgagctaaaagaggctatgaggcttagggctaactttagagattcattgattgattgataagagtacatggggtcactttatatatagggaggacaggcttgacatccaaggaactaatctctagtactacagaaaccagtccaatctctatctctaactttctaataaacctcatctctttcctaattagataatctcctacctatatatgagtaattcgtaatttatgatgcctaaactgctgcatgggcctggtccatgcccataacactacacccctcgcggacagatagtcttcgagcactagcagatatcttcttggaaagaacttcaatggtagcagtcggcaaatcatcaaagcgaagtttgatatttttcttgagttctggccaagtttgaattccgtaggctcgctcaatcaactcataccacattgcggcaaacctggtccggtggcttgatgcaatccaccacttctcttcctccataaattcgctgctcaacaaagaactgctcaatactctccaaccaaatttgcggatcatcctcaccattgaacgttgggagaggttcaaggtggcgaaatctccacatccaattgaaatccccgctgcacgccatcgagggtggagcatcagttggctctgataccaaatgttatggattggctagggtaagggtgcaaagactgggggatagggcactcgccctctaatagcagaggcagggcttcttcctgctgagctaagaggctctgaggcctagggctagctttagagattcattgattgattgattgataatgcagtacgtgggacccctttatatatagggaggacaggcttgatatccaaggaactaatatctagtaccatagaaaccagtgcaatctctatctctaactttctaatagacctcatctctttcctaactagataatctcctacctttatatgagtaattcctaatttataatgcctaaactgctgcatgggcctggtccatgcccataacaaaaggaggtaaacgctatcttatagcttctaaatacggcacacctttatcatccatttctagttttggcttatggaaaaatcttcagttaaagcatttatgatattacaaaattgcagatgacgttttgtcggcatctgaactctcgtgaatctgctgcttgccccttcttagttgttccttaagttgtttcggcctttccaatttagcagtacacttaatcctcatgatccaaccatggccatcaattttcaattttcaactctgagcactctcgaccaatctcccatcagctgggacctattcagctgtctaagacatacattcacaaaggagattgcatgttctgattttcatttttacttgtaaaatgtaatgtttgcatagccattttgtatgtttagcctgaaaatggttgaagcatagttaccagttcatttgttttggtgttttacctgataatgtccagtgtatgaagacatgcgataattgataaattcatatatccggccactcttttacaactgtcactgtgtgggtttaagaaatccctcttttgacaaaccgcagttctctttttcttttccaaagaattgttaatcccacactgaattgctgtattaggaagggatcacctctacaatatgtcatttatgatatgtggtgttgagatgttacgtgttctgttttatttttgacgaaaatgcaggagaactggcattccattaaccattagctaagaaatgtacatggttttatcagtcataaactggacttactattttagaatcatgaactagagttttgctaatggaaattttaccattttaaaaatcatgaactggagtttgaattaatctctgttttatttatttttgagtaaatttcataaaactacatatactttgcatgatctatcacaaaactatagatttaagaacttatttcacaaaactacaaatttaatgtcttcgtttatcacaaaactacaggtattttacacaatatatcacaaaactacagatttaagaacttgtttcacaaaactacagatttaatatcttcatttatcataaaactacaggtttagtgtcttcattatcacaaaactacaggttttagcattgtcaaaacctgtagttttgtgataatggagacactaaatttgtagttttgtgataaatgaagacactaaatgtgtagtcctatgataaacgaatacactaattctatagttttgtgaaacaagttcttaaatctgtagttttgtgatagattgtacaaagtacctgtagttttgtgataaacgggcatactaaatctgtagttttgtgaaacaagctcttaaatctgtagttttgtgataaattgtgcaaaatacatgtagttttgtgaaatttactctttatttttctaacttgctatcctgctccagaaattttccattctagttacatgagtttaagcctcttgtcattttggacgcaatgtcgaacagacctgtatttgatggattttttttgtttatttaagaataagttctctggtacagcttagatacgatggatgattgactaactttttgagcctgtatttcagatattttgtagctgggctgtttactgatgcatgttcttttctcagggccacctgcacacttacaggttctgtgacaatgtatggacattcatcttgactgaagcatcattcaagaacgaggagactacagaacaagttggcaaggtgaagattgtggcctgtgattccaaactactcagccaataaattgataactgcgaggtcagggtttgcctggtatttgttagtctcttctgctagacctggctccgcctgaagtgtactgtaccaccacattgtttgtttcataatcaatgtgtgtcaatacaatcgtatgtgctaccagagtatatcacagcagcaactgttttaatttgtatgcttatgtaattgttatgctactgctgtgttgataatgtgatataaatgactaaacgatgagtagtagaaattgtgcggagtcaccctcccccttcctcatttctgaaccctttggttctgtgtgactctttgtatgtaacatgaacaaatacctcctttcccgtcttttttttggatcctatgttaatggtacctttacatt</dnaseqindica>|
 
−
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001060961.1 RefSeq:Os05g0107700]|
 
−
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 15:18, 6 May 2017

The rice Os05g0107700 was reported as 2003 in 2003 by researchers from USA.

Annotated Information

Gene Symbol

  • Os05g0107700 <=> xa-5, xa5,OsXA5

Function

  • The gene xa5 provides racespecific resistance to X. oryzae pv. oryzae, and encodes the small subunit of transcription factor IIA(TFIIAγ).
  • This recessive gene provides race-specific resistance to X. oryzae pv. oryzae, and is structurally unlike the more than 40 plant R genes previously cloned.
  • xa5 is inherited in a completely recessive manner and the susceptible allele Xa5 is fully dominant.
  • xa5-mediated recessive resistance is the result of restricted bacterial movement, but not restricted multiplication.

Evolution

  • xa5 is a recessive, race-specific R gene that provides immunity to races of Xanthomonas oryzae pv. oryzae expressing avrxa5, the cognate avirulence gene to xa5. X. oryzae pv. oryzae causes rice bacterial blight, a severe disease in South and Southeast Asia. Avrxa5 is likely to be a member of the AvrBs3 family of proteins (Bai et al., 2000; Hopkins et al., 1992), which are usually characterized by nuclear localization signals and transcriptional activation domains (Bonas and Lahaye, 2002).
  • xa5 is a naturally occurring mutation that is most commonly found in the Aus-Boro group of rice (Oryzae sativa L.) varieties from the Bangladeshi region of Asia (Garris et al., 2003).There are over 20 resistance genes to X. oryzae pv. oryzae, three of which have been cloned (Xa21,Xa1, and Xa26) and fall into one of the five typical R gene classes (Song et al., 1995; Sun et al., 2004; Yoshimura et al., 1998). Xa21 and Xa26 both encode NBS-LRR proteins containing a kinase domain, while Xa1 encodes a member of the NBS-LRR class.
  • xa5 does not resemble either of the two cloned recessive resistance genes in plants, mlo or RRS1-R. In contrast to xa5, resistance governed by barley mlois not race-specific (Buschges et al., 1997). Mutations in Mlo result in immunity to nearly all isolates of the fungal pathogen Erysiphe graminis f. sp. hordei. The RRS1-R gene from Arabidopsis provides resistance to several strains of Ralstonia solanacearum and encodes an NBSLRR protein with a WRKY motif characteristic of some plant transcription factors (Deslandes et al., 2002). The RRS1-R gene product physically interacts with its cognate protein PopP2 (Deslandes et al., 2003). Unlike xa5, RRS1-R shares many characteristics with dominant R genes (Deslandes et al., 2003). For example, while genetically defined as recessive, RRS1-R behaves as a dominant gene in transgenic plants and is a member of the NBS-LRR R gene class.

Labs working on this gene

  • Plant Genome Mapping Laboratory, University of Georgia,Riverbend Research Laboratory, Room 162, Athens,GA 30602, USA
  • Institute of Genomic Diversity, Plant Breeding Department,130 Biotechnology Building, Cornell University, USA
  • CIAT - International Center for Tropical Agriculture,A. A. 6713, Cali, Colombia, South America
  • Central Rice Research Institute (CRRI), Cuttack 753 006, India
  • International Rice Research Institute (IRRI), Los Banos, Philippines
  • College of Life Sciences, Wuhan University,Wuhan, 430072, P.R. China
  • Department of Plant Breeding and Genetics, 240 Emerson Hall, Cornell University, Ithaca NY 14853, USA

References

  • (1)A. S. Iyer-Pascuzzi;H. Jiang;L. Huang;and S. R. McCouch. Genetic and Functional Characterization of the Rice Bacterial Blight Disease Resistance Gene xa5. Phytopathology, 2008, 98(3): 289-295
  • (2)Anjali S. Iyer;and Susan R. McCouch. The Rice Bacterial Blight Resistance Gene xa5 Encodes a Novel Form of Disease Resistance. Molecular Plant-Microbe Interactions, 2004, 17(12): 1348-1354
  • (3)Matthew W. Blair;Amanda J. Garris;Anjali S. Iyer;Brad Chapman;Stephen Kresovich;Susan R. McCouch. High resolution genetic mapping and candidate gene identification at the xa5 locus for bacterial blight resistance in rice (Oryza sativa L.). Theoretical and Applied Genetics, 2003, 107(1): 62-73
  • (4)Marella Lalitha Shanti; M. L. C. George; C. M. Vera Cruz; M. A. Bernardo; R. J. Nelson; H. Leung; J. N. Reddy and R. Sridhar. Identification of Resistance Genes Effective Against Rice Bacterial Blight Pathogen in Eastern India. Phytopathology, 2001, 85(5): 506-512
  • (5)D. Yang;A. Sanchez;G. S. Khush;Y. Zhu and N. Huang. Construction of a BAC contig containing the xa5 locus in rice. Theoretical and Applied Genetics, 1998, 97(7): 1120-1124
  • (6)M. W. Blair and S. R. McCouch. Microsatellite and sequence-tagged site markers diagnostic for the rice bacterial leaf blight resistance gene xa-5. Theoretical and Applied Genetics, 1997, 95(1-2): 174-184
  • (7)V. Petpisit;Gurdev S. Khush and H. E. Kauffman. Inheritance of Resistance to Bacterial Blight in Rice. Crop Science, 1977, 17(4): 551-554
  • (8)Identification and gene prediction of a 24 kbregion containing xa5,a recessive bacterial blight resistance gene in rice(Oryza sativa L.)[J]. Chinese Science Bulletin,2003,24:2725-2729.
  • (9)Comparative physical mapping of rice BAC clones linked to resistance genes Glh,Bph-3 and xa-5 in Oryza sativa L. and O. granulata Nees et Arn.ex Watt.[J]. Chinese Science Bulletin,2004,06:591-596.
  • (10)Virulence of Xanthomonas oryzae pv. oryzae on Rice Near-Isogenic Lines with Single Resistance Gene and Pyramiding Lines in China[J]. Agricultural Sciences in China,2004,10:45-50.
  • (11)Application of Functional Markers to Identify Genes for Bacterial Blight Resistance in Oryza rufipogon[J]. Rice Science,2010,01:73-76.
  • (12)Identification of an avirulence gene,avrxa5,from the rice pathogen Xanthomonas oryzae pv.oryzae[J]. Science China(Life Sciences),2010,12:1440-1449.
  • (13)Evaluation of the Pathotypes of Xanthomonas oryzae pv. oryzae and Preliminary Analysis of the Resistant Reactions of Main Japonica Rice in the Yunnan Plateau, China[J]. Agricultural Sciences in China,2006,04:299-306.

Structured Information

Retrieved from "https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os05g0107700&oldid=277856"