Difference between revisions of "Os10g0148000"

From RiceWiki
Jump to: navigation, search
 
(36 intermediate revisions by 5 users not shown)
Line 1: Line 1:
''OsDIL'' is a stress-responsive gene and it is short for Oryza sativa Drought-Induced LTP.  
+
The rice '''''Os10g0148000''''' was reported as '''''OsDIL''''' in 2013 <ref name="ref1" /> by researchers from China.  
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os10g0148000''''' '''<=>''' '''''DIL, OsDIL, OsLTP6, OsLTPd11, OsLtpVI.3'''''
 +
 
===Function===
 
===Function===
''OsDIL'' (Os10g0148000) encoding a lipid transfer protein. was found to be up-regulated in flowers under drought.OsDIL was primarily expressed in the anther and mainly responsive to abiotic stresses, including drought, cold, NaCl, and stress-related plant hormone abscisic acid (ABA). Compared with wild type, the OsDIL-overexpressing transgenic rice plants were more tolerant to drought stress during vegetative development and showed
+
* '''''OsDIL''''' is a stress-responsive gene and it is short for Oryza sativa Drought-Induced LTP.
less severe tapetal defects and fewer defective anther sacs when treated with drought at the reproductive stages<references /> [1].
+
* ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein.  
 +
 
 +
==Phenotypic analysis==
 +
* Compared with wild type, the OsDIL-overexpressing transgenic rice plants were more tolerant to drought stress during vegetative development and showed less severe tapetal defects and fewer defective anther sacs when treated with drought at the reproductive stages<ref name="ref1" />.
  
 
===Expression===
 
===Expression===
''OsDIL'' (Os10g0148000) encoding a lipid transfer protein, OsDIL has an open reading frame of 348 bp, encoding a basic protein of 115 amino acids with a calculated molecular weight of 12.22 kDa and a pI of 5.67. Analysis of the OsDIL sequence using the SignalP program (http://genome.cbs.
+
* OsDIL was primarily expressed in the anther and mainly responsive to abiotic stresses, including drought, cold, NaCl, and stress-related plant hormone abscisic acid (ABA).  
dtu.dk/services/SignalP) revealed a putative cleavage site for a signal peptide between residues 26 (A) and 27 (G).OsDIL contains an N-terminal region with 17 hydrophobic residues (9–26 aa) similar to typical signal peptides for the secretory pathway and eight cysteine residues highly conserved in plant ns-LTP family .
+
* It was also observed found to be up-regulated in flowers under drought.
 
 
 
 
===Evolution===
 
Please input evolution information here.
 
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* State Key Laboratory of Genetic Engineering, Institute of Plant Biology, Center for Evolutionary Biology, School of Life Sciences, Fudan University, 220 Handan Road, Shanghai 200433, China.
  
 
==References==
 
==References==
<ref>...</ref> Guo, C., et al. (2013). "The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages." Plant Mol Biol 82(3): 239-253 .
+
<references>
==Structured Information==
+
* <ref name="ref1">Guo, C., et al. (2013). "The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages." Plant Mol Biol 82(3): 239-253 .
{{JaponicaGene|
+
</ref>
GeneName = Os10g0148000|
+
</references>
Description = Plant lipid transfer/seed storage/trypsin-alpha amylase inhibitor domain containing protein|
+
== Structured Information ==
Version = NM_001070697.2 GI:297610101 GeneID:4348109|
 
Length = 1111 bp|
 
Definition = Oryza sativa Japonica Group Os10g0148000, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|
 
AP = Chromosome 10:2864478..2865588|
 
CDS = 2864524..2864871|
 
GCID = <gbrowseImage1>
 
name=NC_008403:2864478..2865588
 
source=RiceChromosome10
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008403:2864478..2865588
 
source=RiceChromosome10
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactga</cdnaseq>|
 
AA = <aaseq>MSQLKSSSLAALLIFLLAVFTTAAAAAGTECQNDVEVLKTTCYK                    FVEKDGPKLQPSPDCCTSMKGVNVPCVCTYLGSPGVRDNINMDKVFYVTKQCGIAIPG                    NCGGEQASLDWPH</aaseq>|
 
DNA = <dnaseqindica>47..394#ttaatcagagaagttcaagatatcagaaagaacaacacataccaggatgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactgatcacctgggtaagaactgacaataacacgccggctcctctggattgcgacttccagtggggcccaggtgtcggtgtcagctgggtaagttggtgtcatctggtatgggaaactttgatgttttgtacatgtggtggtgctcttgtcaacattatatagataaggagagaataggacaaacatgacgcttgaatagcagaagagaagttctatccagcaatatcaaaagtacagctgtcattttcaaaaaatgtaaaacaaaaataaaacgaaaaacccactatactagtgccaataaaagaagaaacaaaagagaactacattattgtcaatgccatttgttgatgttattattacttttgtttataagaataacaattgtacttataaggcctacgatttattacaggatccaaggtctaaaacaagaactgattgacttggtgaagttggctgacaaaagcaaggcacctagcagttgcacggctgatataggtaaataatgttggtcaacttttagagtacacggattgtacgtcaaccttcagcatgttgtgataacaaaatatgtatcaatgatggttgtctatatacactgaaaatgcaagagtatttttaaatcacatgttgtattgagtattgacccagctatcaactgtttgttgatgtgccctgttccttagtctgataaatgctaatatagcacattgctaaaagc</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001070697.2 RefSeq:Os10g0148000]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 15:56, 6 May 2017

The rice Os10g0148000 was reported as OsDIL in 2013 [1] by researchers from China.

Annotated Information

Gene Symbol

  • Os10g0148000 <=> DIL, OsDIL, OsLTP6, OsLTPd11, OsLtpVI.3

Function

  • OsDIL is a stress-responsive gene and it is short for Oryza sativa Drought-Induced LTP.
  • OsDIL (Os10g0148000) encoding a lipid transfer protein.

Phenotypic analysis

  • Compared with wild type, the OsDIL-overexpressing transgenic rice plants were more tolerant to drought stress during vegetative development and showed less severe tapetal defects and fewer defective anther sacs when treated with drought at the reproductive stages[1].

Expression

  • OsDIL was primarily expressed in the anther and mainly responsive to abiotic stresses, including drought, cold, NaCl, and stress-related plant hormone abscisic acid (ABA).
  • It was also observed found to be up-regulated in flowers under drought.

You can also add sub-section(s) at will.

Labs working on this gene

  • State Key Laboratory of Genetic Engineering, Institute of Plant Biology, Center for Evolutionary Biology, School of Life Sciences, Fudan University, 220 Handan Road, Shanghai 200433, China.

References

  1. 1.0 1.1 Guo, C., et al. (2013). "The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages." Plant Mol Biol 82(3): 239-253 .

Structured Information