|
|
| (26 intermediate revisions by 5 users not shown) |
| Line 1: |
Line 1: |
| − | ''OsDIL'' is a stress-responsive gene and it is short for Oryza sativa Drought-Induced LTP. | + | The rice '''''Os10g0148000''''' was reported as '''''OsDIL''''' in 2013 <ref name="ref1" /> by researchers from China. |
| | ==Annotated Information== | | ==Annotated Information== |
| | + | ===Gene Symbol=== |
| | + | *'''''Os10g0148000''''' '''<=>''' '''''DIL, OsDIL, OsLTP6, OsLTPd11, OsLtpVI.3''''' |
| | + | |
| | ===Function=== | | ===Function=== |
| − | ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein. was found to be up-regulated in flowers under drought.OsDIL was primarily expressed in the anther and mainly responsive to abiotic stresses, including drought, cold, NaCl, and stress-related plant hormone abscisic acid (ABA). Compared with wild type, the OsDIL-overexpressing transgenic rice plants were more tolerant to drought stress during vegetative development and showed | + | * '''''OsDIL''''' is a stress-responsive gene and it is short for Oryza sativa Drought-Induced LTP. |
| − | less severe tapetal defects and fewer defective anther sacs when treated with drought at the reproductive stages<references /> [1]. | + | * ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein. |
| | + | |
| | + | ==Phenotypic analysis== |
| | + | * Compared with wild type, the OsDIL-overexpressing transgenic rice plants were more tolerant to drought stress during vegetative development and showed less severe tapetal defects and fewer defective anther sacs when treated with drought at the reproductive stages<ref name="ref1" />. |
| | | | |
| | ===Expression=== | | ===Expression=== |
| − | ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein, OsDIL has an open reading frame of 348 bp, encoding a basic protein of 115 amino acids with a calculated molecular weight of 12.22 kDa and a pI of 5.67. Analysis of the OsDIL sequence using the SignalP program (http://genome.cbs. dtu.dk/services/SignalP) revealed a putative cleavage site for a signal peptide between residues 26 (A) and 27 (G).OsDIL contains an N-terminal region with 17 hydrophobic residues (9–26 aa) similar to typical signal peptides for the secretory pathway and eight cysteine residues highly conserved in plant ns-LTP family .
| + | * OsDIL was primarily expressed in the anther and mainly responsive to abiotic stresses, including drought, cold, NaCl, and stress-related plant hormone abscisic acid (ABA). |
| − | To further examine the expression pattern of OsDIL, a qRT-PCR experiment was performed and the result showed that OsDIL was expressed in all tested tissues, with relatively high levels of expression in post-meiotic flowers, especially in the anther (Fig. 1a, b).The results suggest that OsDIL is important for the anther development. Because genes induced by one stress condition might also be regulated by other environmental signals, so the expression of OsDIL at the vegetative stage in response to different stresses was examined. The results showed that OsDIL was greatly induced by treatments with PEG6000 (20 %), NaCl (150 mM) or cold (4℃) (Fig. 1c), as well as by ABA (5 lM) (Fig. 1c), indicating that OsDIL is a stress responsive gene.
| + | * It was also observed found to be up-regulated in flowers under drought. |
| − | [[File:Fig.1.jpg|450px|thumb|center|Fig1]]
| |
| − | | |
| − | ===Evolution===
| |
| − | Please input evolution information here.
| |
| | | | |
| | You can also add sub-section(s) at will. | | You can also add sub-section(s) at will. |
| | | | |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| − | Please input related labs here.
| + | * State Key Laboratory of Genetic Engineering, Institute of Plant Biology, Center for Evolutionary Biology, School of Life Sciences, Fudan University, 220 Handan Road, Shanghai 200433, China. |
| | | | |
| | ==References== | | ==References== |
| − | <ref>...</ref> Guo, C., et al. (2013). "The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages." Plant Mol Biol 82(3): 239-253 . | + | <references> |
| − | ==Structured Information==
| + | * <ref name="ref1">Guo, C., et al. (2013). "The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages." Plant Mol Biol 82(3): 239-253 . |
| − | {{JaponicaGene|
| + | </ref> |
| − | GeneName = Os10g0148000|
| + | </references> |
| − | Description = Plant lipid transfer/seed storage/trypsin-alpha amylase inhibitor domain containing protein|
| + | == Structured Information == |
| − | Version = NM_001070697.2 GI:297610101 GeneID:4348109|
| |
| − | Length = 1111 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os10g0148000, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| − | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|
| |
| − | AP = Chromosome 10:2864478..2865588|
| |
| − | CDS = 2864524..2864871|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008403:2864478..2865588
| |
| − | source=RiceChromosome10
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>| | |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008403:2864478..2865588
| |
| − | source=RiceChromosome10
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>| | |
| − | CDNA = <cdnaseq>atgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactga</cdnaseq>|
| |
| − | AA = <aaseq>MSQLKSSSLAALLIFLLAVFTTAAAAAGTECQNDVEVLKTTCYK FVEKDGPKLQPSPDCCTSMKGVNVPCVCTYLGSPGVRDNINMDKVFYVTKQCGIAIPG NCGGEQASLDWPH</aaseq>|
| |
| − | DNA = <dnaseqindica>47..394#ttaatcagagaagttcaagatatcagaaagaacaacacataccaggatgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactgatcacctgggtaagaactgacaataacacgccggctcctctggattgcgacttccagtggggcccaggtgtcggtgtcagctgggtaagttggtgtcatctggtatgggaaactttgatgttttgtacatgtggtggtgctcttgtcaacattatatagataaggagagaataggacaaacatgacgcttgaatagcagaagagaagttctatccagcaatatcaaaagtacagctgtcattttcaaaaaatgtaaaacaaaaataaaacgaaaaacccactatactagtgccaataaaagaagaaacaaaagagaactacattattgtcaatgccatttgttgatgttattattacttttgtttataagaataacaattgtacttataaggcctacgatttattacaggatccaaggtctaaaacaagaactgattgacttggtgaagttggctgacaaaagcaaggcacctagcagttgcacggctgatataggtaaataatgttggtcaacttttagagtacacggattgtacgtcaaccttcagcatgttgtgataacaaaatatgtatcaatgatggttgtctatatacactgaaaatgcaagagtatttttaaatcacatgttgtattgagtattgacccagctatcaactgtttgttgatgtgccctgttccttagtctgataaatgctaatatagcacattgctaaaagc</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001070697.2 RefSeq:Os10g0148000]|
| |
| − | }}
| |
| | [[Category:Genes]] | | [[Category:Genes]] |
| | [[Category:Japonica mRNA]] | | [[Category:Japonica mRNA]] |
