Difference between revisions of "Os11g0454000"

From RiceWiki
Jump to: navigation, search
 
(9 intermediate revisions by 5 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os11g0454000''''' was reported as '''''rab16C''''' in 1990 by researchers from Japan.  
The description of the rice '''Os11g0454000'''gene is the  ''rab 16c'' gene. The  ''rab 16c'' is ABA response protein.Therefore, the rice '''Os11g0454000'''gene is a functional gene in response to abiotic stresses, such as drought and salt.
 
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os11g0454000''''' '''<=>''' '''''OsLEA27, rab16C, rab21'''''
 +
 
===Function===
 
===Function===
Please input function information here.
+
* The  '''''rab16c''''' is ABA response protein. It is a functional gene in response to abiotic stresses, such as drought and salt.
Drought and salt are two adverse factors affecting seriously growth, development, and productivity of rice. when subjecting rice to drought and salt as stresses, plants increase ABA sensitivity in rice . The  ''rab 16c'' gene and other functional genes are expression in a high level to response to the stresses.
+
* The  ''rab 16c'' gene and other functional genes are expression in a high level to response to the stresses.
The expression of ''rab 16c''is controlled by ABA which appears to mediate important physiological and developmental processes in plants. These include embryo morphogenesis and germination in seeds as well
+
* The expression of ''rab 16c''is controlled by ABA which appears to mediate important physiological and developmental processes in plants. These include embryo morphogenesis and germination in seeds as well as stomatal function and the response of plant tissues to osmotic stress.
as stomatal function and the response of plant tissues to osmotic stress.
+
 
 
===Expression===
 
===Expression===
Please input expression information here.
+
* Its expression is not tissue specific high in ABA-treated seedlings and roots and  responsive to osmotic stress.  
Its expression is not tissue specific high in ABA-treated seedlings and roots and  responsive to osmotic stress. Its mRNA accumulates to detectable levels in mature embryos.
+
* Its mRNA accumulates to detectable levels in mature embryos.
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
* Two types of conserved DNA sequence motifs are found in the promoter regions of the ''rab 16C'' genes.  
Two types of conserved DNA sequence motifs are found in the promoter regions of the ''rab 16C'' genes . The core of Motif I (PuTACGTGGCPu), reminiscent of the cAMP response element (TGACGTA [5]), appears to be conserved in the promoter regions of several cotton lea genes. The
+
* The core of Motif I (PuTACGTGGCPu), reminiscent of the cAMP response element (TGACGTA [5]), appears to be conserved in the promoter regions of several cotton lea genes.  
core of Motif II (CGG/CCGCGCT), found once in ''rab 16C'', is 80% homologous with the binding site of SP1, an auxilliary transcription factor . These elements may play a role in modulating the transcriptional activation in the rab genes.Another conserved sequence, whose core is found in the promoter regions of ABA-responsive cotton genes, is reminiscent of the cAMP responsive element.
+
* The core of Motif II (CGG/CCGCGCT), found once in ''rab 16C'', is 80% homologous with the binding site of SP1, an auxilliary transcription factor.  
Ose717 shared a 91% homology with the 140 nucleotide coding sequences of a rice ABA response gene, ''rab16C''. The high degree of homology within the coding region implied that the genes were closely related.
+
* These elements may play a role in modulating the transcriptional activation in the rab genes.Another conserved sequence, whose core is found in the promoter regions of ABA-responsive cotton genes, is reminiscent of the cAMP responsive element.
 +
* Ose717 shared a 91% homology with the 140 nucleotide coding sequences of a rice ABA response gene, ''rab16C''. The high degree of homology within the coding region implied that the genes were closely related.
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* Laboratory  of Plant Molecular  Biology,  Rockefeller  University,  1230 York Avenue, New York, NY 10021, USA
 +
* Department of Biotechnology, Carlsberg Research  Laboratory, GI. Carlsberg  Vej 10, DK-2500 Valby, Copenhagen, Denmark
 +
* Department of Cell Biology,  National Institute of Agrobiological  Resources,  Yatabe, Ibaraki 305, Japan
  
 
==References==
 
==References==
Please input cited references here.
+
* [1]Yamaguchi-Shinozaki, K., J. Mundy, and N.H. Chua. Four tightly linked rab genes are differentially expressed in rice. Plant Mol. Biol.(1990) 14: 29_39.
[1]Yamaguchi-Shinozaki, K., J. Mundy, and N.H. Chua. Four tightly linked rab genes are differentially expressed in rice. Plant Mol. Biol.(1990) 14: 29_39.
+
 
[2]Peng-Wen Chen1, Li-Wen Fang2, Juey-Wen Lin3, et al.Isolation of cDNA clones for genes that are specifically expressed in the rice embryo.Bot. Bull. Acad. Sin. (1997) 38: 13-20.
+
* [2]Peng-Wen Chen1, Li-Wen Fang2, Juey-Wen Lin3, et al.Isolation of cDNA clones for genes that are specifically expressed in the rice embryo.Bot. Bull. Acad. Sin. (1997) 38: 13-20.
[3]Hao-Wen Li, Bai-Sheng Zang, Xing-Wang Deng,et al.Overexpression of the trehalose-6-phosphate synthase gene OsTPS1 enhances abiotic stress tolerance in rice.Planta (2011) 234:1007–1018.
+
 
[4]NÉLIDA OLAVE-CONCHA1, SIMÓN RUIZ-LARA2, XIMENA MUÑOZ1, et al.Accumulation of dehydrin transcripts and proteins in response to abiotic stresses in Deschampsia antarctica. Antarctic Science (2004)16 (2): 175–184.
+
* [3]Hao-Wen Li, Bai-Sheng Zang, Xing-Wang Deng,et al.Overexpression of the trehalose-6-phosphate synthase gene OsTPS1 enhances abiotic stress tolerance in rice.Planta (2011) 234:1007–1018.
[5]John Mundy, Nam-Hal Chua. Abscisic acid and water-stress induce the expression of a novel rice gene.The EMBO Journal (1988) 7(8): 2279-2286.
 
  
 +
* [4]NÉLIDA OLAVE-CONCHA1, SIMÓN RUIZ-LARA2, XIMENA MUÑOZ1, et al.Accumulation of dehydrin transcripts and proteins in response to abiotic stresses in Deschampsia antarctica. Antarctic Science (2004)16 (2): 175–184.
 +
 +
* [5]John Mundy, Nam-Hal Chua. Abscisic acid and water-stress induce the expression of a novel rice gene.The EMBO Journal (1988) 7(8): 2279-2286.
  
==Structured Information==
 
{{JaponicaGene|
 
GeneName = Os11g0454000|
 
Description = Dehydrin RAB 16C|
 
Version = NM_001074374.1 GI:115485396 GeneID:4350452|
 
Length = 889 bp|
 
Definition = Oryza sativa Japonica Group Os11g0454000, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|
 
AP = Chromosome 11:17154225..17155113|
 
CDS = 17154447..17154713,17154809..17155036|
 
GCID = <gbrowseImage1>
 
name=NC_008404:17154225..17155113
 
source=RiceChromosome11
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008404:17154225..17155113
 
source=RiceChromosome11
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggagaactaccaggggcagcacggctacggcgccgaccgcgtcgacgtgtacggcaacccggtcgccggccagtacggcggcggcgccaccgctcccggcggaggccatggcgtgatgggaatgggagggcatcacgccggcgccggcgggcagttccagccggtgaaggaggagcacaagaccggcggcatcctccaccgctccggcagctcaagctccagctcgtcgtctgaggacgacgggatgggagggaggaggaagaagggaatcaaggagaagatcaaggagaagctccccggcggcaacaagggcaacaaccagcagcagcagcagatgatggggaacaccggcggcgcgtacgggcagcaggggcacgccgggatgaccggcgccggcaccggcaccggcgtgcacggtgcggagtacggcaacaccggcgagaagaagggcttcatggacaagatcaaggaaaagcttcccggccagcactaa</cdnaseq>|
 
AA = <aaseq>MENYQGQHGYGADRVDVYGNPVAGQYGGGATAPGGGHGVMGMGG                    HHAGAGGQFQPVKEEHKTGGILHRSGSSSSSSSSEDDGMGGRRKKGIKEKIKEKLPGG                    NKGNNQQQQQMMGNTGGAYGQQGHAGMTGAGTGTGVHGAEYGNTGEKKGFMDKIKEKL                    PGQH</aaseq>|
 
DNA = <dnaseqindica>401..667#78..305#atcgatcacaagacacaagatttttcactgatagaatagcaacacttgggtgagagatcagacgcgtgtttgagaagatggagaactaccaggggcagcacggctacggcgccgaccgcgtcgacgtgtacggcaacccggtcgccggccagtacggcggcggcgccaccgctcccggcggaggccatggcgtgatgggaatgggagggcatcacgccggcgccggcgggcagttccagccggtgaaggaggagcacaagaccggcggcatcctccaccgctccggcagctcaagctccagctcggtacgttcactgtcgtccattcataaatctaattaatcgcctcgcttctgaattcctttatttaatttgagttgtactcgtgtgcgtttgtgcagtcgtctgaggacgacgggatgggagggaggaggaagaagggaatcaaggagaagatcaaggagaagctccccggcggcaacaagggcaacaaccagcagcagcagcagatgatggggaacaccggcggcgcgtacgggcagcaggggcacgccgggatgaccggcgccggcaccggcaccggcgtgcacggtgcggagtacggcaacaccggcgagaagaagggcttcatggacaagatcaaggaaaagcttcccggccagcactaaataagctcgaccgggtcgtcaccaaatatgtcgtgatgtacgtgcagttttatatgttgttgaataaactagcgtgaaatgcgagtgatggtgtcttctgccttgggacggatgacacattgtctgttgtgttctcgcgtccgtgtcggttttacccttgaaatgtaatatggtgtgtgtacacactaaggttttattgaagtgtgactttgtgcttgtgtt</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001074374.1 RefSeq:Os11g0454000]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]
Line 69: Line 45:
 
[[Category:Japonica Chromosome 11]]
 
[[Category:Japonica Chromosome 11]]
 
[[Category:Chromosome 11]]
 
[[Category:Chromosome 11]]
 +
 +
== Structured Information ==

Latest revision as of 15:57, 6 May 2017

The rice Os11g0454000 was reported as rab16C in 1990 by researchers from Japan.

Annotated Information

Gene Symbol

  • Os11g0454000 <=> OsLEA27, rab16C, rab21

Function

  • The rab16c is ABA response protein. It is a functional gene in response to abiotic stresses, such as drought and salt.
  • The rab 16c gene and other functional genes are expression in a high level to response to the stresses.
  • The expression of rab 16cis controlled by ABA which appears to mediate important physiological and developmental processes in plants. These include embryo morphogenesis and germination in seeds as well as stomatal function and the response of plant tissues to osmotic stress.

Expression

  • Its expression is not tissue specific high in ABA-treated seedlings and roots and responsive to osmotic stress.
  • Its mRNA accumulates to detectable levels in mature embryos.

Evolution

  • Two types of conserved DNA sequence motifs are found in the promoter regions of the rab 16C genes.
  • The core of Motif I (PuTACGTGGCPu), reminiscent of the cAMP response element (TGACGTA [5]), appears to be conserved in the promoter regions of several cotton lea genes.
  • The core of Motif II (CGG/CCGCGCT), found once in rab 16C, is 80% homologous with the binding site of SP1, an auxilliary transcription factor.
  • These elements may play a role in modulating the transcriptional activation in the rab genes.Another conserved sequence, whose core is found in the promoter regions of ABA-responsive cotton genes, is reminiscent of the cAMP responsive element.
  • Ose717 shared a 91% homology with the 140 nucleotide coding sequences of a rice ABA response gene, rab16C. The high degree of homology within the coding region implied that the genes were closely related.

You can also add sub-section(s) at will.

Labs working on this gene

  • Laboratory of Plant Molecular Biology, Rockefeller University, 1230 York Avenue, New York, NY 10021, USA
  • Department of Biotechnology, Carlsberg Research Laboratory, GI. Carlsberg Vej 10, DK-2500 Valby, Copenhagen, Denmark
  • Department of Cell Biology, National Institute of Agrobiological Resources, Yatabe, Ibaraki 305, Japan

References

  • [1]Yamaguchi-Shinozaki, K., J. Mundy, and N.H. Chua. Four tightly linked rab genes are differentially expressed in rice. Plant Mol. Biol.(1990) 14: 29_39.
  • [2]Peng-Wen Chen1, Li-Wen Fang2, Juey-Wen Lin3, et al.Isolation of cDNA clones for genes that are specifically expressed in the rice embryo.Bot. Bull. Acad. Sin. (1997) 38: 13-20.
  • [3]Hao-Wen Li, Bai-Sheng Zang, Xing-Wang Deng,et al.Overexpression of the trehalose-6-phosphate synthase gene OsTPS1 enhances abiotic stress tolerance in rice.Planta (2011) 234:1007–1018.
  • [4]NÉLIDA OLAVE-CONCHA1, SIMÓN RUIZ-LARA2, XIMENA MUÑOZ1, et al.Accumulation of dehydrin transcripts and proteins in response to abiotic stresses in Deschampsia antarctica. Antarctic Science (2004)16 (2): 175–184.
  • [5]John Mundy, Nam-Hal Chua. Abscisic acid and water-stress induce the expression of a novel rice gene.The EMBO Journal (1988) 7(8): 2279-2286.

Structured Information