Difference between revisions of "Os10g0573400"

From RiceWiki
Jump to: navigation, search
(Function)
(Labs working on this gene)
 
(44 intermediate revisions by 5 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os10g0573400''''' was reported as '''''OsPYL''''' in 2012 <ref name="ref1" /> by researchers from Korea.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
[[File:wz1.jpg|327px|thumb|right]]
 +
===Gene Symbol===
 +
*'''''Os02g0187800''''' '''''<=>''''' '''''OsPYL/RCAR10, OsPYL1, OsPYL10, PYL1, PYL10'''''
 +
 
===Function===
 
===Function===
Please input function information here.
+
* '''''OsPYL''''' is a positive regulator of the ABA signal transduction pathway in seed germination and early seedling growth
 +
* Abscisic acid (ABA) is a phytohormone that positively regulates seed dormancy and stress tolerance.<ref name="ref1" /><ref name="ref2" /><ref name="ref3" />
  
BE EDITING!!!!!!
+
===Phenotypic analysis===
17:18, 19 May 2014 (CST)~
+
* Transgenic rice plants expressing OsPYL/RCAR5, a PYL/RCAR orthologue of rice, were found to be hypersensitive to ABA during seed germination and early seedling growth.
 +
* Constitutive expression of OsPYL/RCAR5 increases expression of the ABA-responsive genes under ABA treatment
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
* This gene is related to the expression of ABA metabolism and its signaling pathways.  
 +
* Proteins related to ABA signaling pathways may have a higher expression variation among different organs or stress responses in comparison with those of ABA metabolism. <ref name="ref2" />
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
* It is the common ancestor of many species such as ''A. thaliana'', ''Arabidopsis lyrata'', ''Populustrichocarpa'', ''Oryza sativa'', ''Selaginella moellendorffii'', and ''Physcomitrella patens''.
 +
* Twelve ABA receptor orthologs named OsPYL1–12 in Oryza sativa (OsPYLs) are identified. OsPYL1 corresponds to Os10g0573400 which is showed in the following chaters. <ref name="ref3" />
  
You can also add sub-section(s) at will.
+
* Phylogenetic relationships in orthologous cluster 7 including ABA receptor genes. An orthologous cluster (OC) is defined to have genes diverged in each species from a gene in the common ancestor of these six species.   <ref name="ref2" />
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* Department of Bio-crop development, National Academy of Agricultural Science, Rural Development Administration, Suwon,441-707 Korea
 +
* Department of Biological Sciences, Sungkyunkwan University, Suwon, 440-746 Korea
 +
* Department of Genetic Engineering, Sungkyunkwan University, Suwon, 440-746 Korea
 +
* School of Biological Sciences (BK21 program), Chung-Ang University, Seoul, 156-756 Korea
  
 
==References==
 
==References==
Please input cited references here.
 
  
==Structured Information==
+
<references>
{{JaponicaGene|
+
<ref name="ref1">
GeneName = Os10g0573400|
+
Kim H, Hwang H, Hong JW, Lee YN, Ahn IP, Yoon IS, Yoo SD, Lee S, Lee SC, Kim
Description = Conserved hypothetical protein|
+
BG. A rice orthologue of the ABA receptor, OsPYL/RCAR5, is a positive regulator
Version = NM_001072002.1 GI:115483599 GeneID:4349472|
+
of the ABA signal transduction pathway in seed germination and early seedling
Length = 1089 bp|
+
growth. J Exp Bot. 2012 Jan;63(2):1013-24. doi: 10.1093/jxb/err338. Epub 2011 Nov
Definition = Oryza sativa Japonica Group Os10g0573400, complete gene.|
+
9. PubMed PMID: 22071266.</ref>
Source = Oryza sativa Japonica Group
+
 
 +
<ref name="ref2">He Y, Hao Q, Li W, et al. Identification and Characterization of ABA Receptors in Oryza sativa[J]. PloS one, 2014, 9(4): e95246.</ref>
 +
 
 +
<ref name="ref3">Hanada K, Hase T, Toyoda T, et al. Origin and evolution of genes related to ABA metabolism and its signaling pathways[J]. Journal of plant research, 2011, 124(4): 455-465.</ref>
 +
</references>
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|
 
AP = Chromosome 10:23221607..23222695|
 
CDS = 23221741..23222379|
 
GCID = <gbrowseImage1>
 
name=NC_008403:23221607..23222695
 
source=RiceChromosome10
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008403:23221607..23222695
 
source=RiceChromosome10
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggagcagcaggaggaagtgccaccgccgccggcggggctggggctgacggcggaggagtacgcgcaggtgcgggcgacggtggaggcgcaccaccgctacgccgtggggccgggccaatgctcctccctcctcgcgcagcgcatccacgcgccgcccgccgccgtctgggccgtcgtccgccgcttcgactgcccccaggtgtacaagcacttcatccgcagctgcgtcctccggcccgacccccaccacgacgacaacggcaacgacctccgccccggccgcctccgcgaggtcagcgtcatctccggcctccccgccagcaccagcaccgagcgcctcgacctcctcgacgacgcccaccgcgtcttcggcttcaccatcaccggcggcgagcaccgcctccgcaactaccgatccgtcaccaccgtctcccagctcgacgagatctgcaccctcgtcctcgagtcctacatcgtcgacgtccccgacggcaacaccgaggacgacacccgcctcttcgccgacaccgtcatcaggctcaacctccagaagctcaagtccgtctccgaggccaacgccaacgccgctgccgccgccgccgctcctcctcctcctccaccggcggcggcggaatag</cdnaseq>|
 
AA = <aaseq>MEQQEEVPPPPAGLGLTAEEYAQVRATVEAHHRYAVGPGQCSSL                    LAQRIHAPPAAVWAVVRRFDCPQVYKHFIRSCVLRPDPHHDDNGNDLRPGRLREVSVI                    SGLPASTSTERLDLLDDAHRVFGFTITGGEHRLRNYRSVTTVSQLDEICTLVLESYIV                    DVPDGNTEDDTRLFADTVIRLNLQKLKSVSEANANAAAAAAAPPPPPPAAAE</aaseq>|
 
DNA = <dnaseqindica>135..773#aaatcccaattccccatctggctcgctcgacatcttcttcactcctcacttcccccactttctctactcctagcatagcagcctcactttccctcctcgatcgaagcagcaggcggaggcggaggggatcggcgatggagcagcaggaggaagtgccaccgccgccggcggggctggggctgacggcggaggagtacgcgcaggtgcgggcgacggtggaggcgcaccaccgctacgccgtggggccgggccaatgctcctccctcctcgcgcagcgcatccacgcgccgcccgccgccgtctgggccgtcgtccgccgcttcgactgcccccaggtgtacaagcacttcatccgcagctgcgtcctccggcccgacccccaccacgacgacaacggcaacgacctccgccccggccgcctccgcgaggtcagcgtcatctccggcctccccgccagcaccagcaccgagcgcctcgacctcctcgacgacgcccaccgcgtcttcggcttcaccatcaccggcggcgagcaccgcctccgcaactaccgatccgtcaccaccgtctcccagctcgacgagatctgcaccctcgtcctcgagtcctacatcgtcgacgtccccgacggcaacaccgaggacgacacccgcctcttcgccgacaccgtcatcaggctcaacctccagaagctcaagtccgtctccgaggccaacgccaacgccgctgccgccgccgccgctcctcctcctcctccaccggcggcggcggaatagcctttttcttttctttttggacctctctgcaatttcacttctattcagggaggtgcttcgaatttgctccatgtctcatgaagttggaggaggaagggtcagcttctaatacatctcattcctggtggtgctgcctgtaataatctcttcatcttcttttttcctctcctcctcctcttctcttcctggatttcttttgcttggaatttttacttacctttgtgtgtgtgtctcacttcctgattggaatccatatttgcttttcggtggttttgttcttcattcaaattcaaattaatctatctagcatttgttc</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001072002.1 RefSeq:Os10g0573400]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]
Line 60: Line 51:
 
[[Category:Japonica Chromosome 10]]
 
[[Category:Japonica Chromosome 10]]
 
[[Category:Chromosome 10]]
 
[[Category:Chromosome 10]]
 +
==Structured Information==

Latest revision as of 02:27, 7 May 2017

The rice Os10g0573400 was reported as OsPYL in 2012 [1] by researchers from Korea.

Annotated Information

Wz1.jpg

Gene Symbol

  • Os02g0187800 <=> OsPYL/RCAR10, OsPYL1, OsPYL10, PYL1, PYL10

Function

  • OsPYL is a positive regulator of the ABA signal transduction pathway in seed germination and early seedling growth
  • Abscisic acid (ABA) is a phytohormone that positively regulates seed dormancy and stress tolerance.[1][2][3]

Phenotypic analysis

  • Transgenic rice plants expressing OsPYL/RCAR5, a PYL/RCAR orthologue of rice, were found to be hypersensitive to ABA during seed germination and early seedling growth.
  • Constitutive expression of OsPYL/RCAR5 increases expression of the ABA-responsive genes under ABA treatment

Expression

  • This gene is related to the expression of ABA metabolism and its signaling pathways.
  • Proteins related to ABA signaling pathways may have a higher expression variation among different organs or stress responses in comparison with those of ABA metabolism. [2]

Evolution

  • It is the common ancestor of many species such as A. thaliana, Arabidopsis lyrata, Populustrichocarpa, Oryza sativa, Selaginella moellendorffii, and Physcomitrella patens.
  • Twelve ABA receptor orthologs named OsPYL1–12 in Oryza sativa (OsPYLs) are identified. OsPYL1 corresponds to Os10g0573400 which is showed in the following chaters. [3]
  • Phylogenetic relationships in orthologous cluster 7 including ABA receptor genes. An orthologous cluster (OC) is defined to have genes diverged in each species from a gene in the common ancestor of these six species. [2]

Labs working on this gene

  • Department of Bio-crop development, National Academy of Agricultural Science, Rural Development Administration, Suwon,441-707 Korea
  • Department of Biological Sciences, Sungkyunkwan University, Suwon, 440-746 Korea
  • Department of Genetic Engineering, Sungkyunkwan University, Suwon, 440-746 Korea
  • School of Biological Sciences (BK21 program), Chung-Ang University, Seoul, 156-756 Korea

References

  1. 1.0 1.1 Kim H, Hwang H, Hong JW, Lee YN, Ahn IP, Yoon IS, Yoo SD, Lee S, Lee SC, Kim BG. A rice orthologue of the ABA receptor, OsPYL/RCAR5, is a positive regulator of the ABA signal transduction pathway in seed germination and early seedling growth. J Exp Bot. 2012 Jan;63(2):1013-24. doi: 10.1093/jxb/err338. Epub 2011 Nov 9. PubMed PMID: 22071266.
  2. 2.0 2.1 2.2 He Y, Hao Q, Li W, et al. Identification and Characterization of ABA Receptors in Oryza sativa[J]. PloS one, 2014, 9(4): e95246.
  3. 3.0 3.1 Hanada K, Hase T, Toyoda T, et al. Origin and evolution of genes related to ABA metabolism and its signaling pathways[J]. Journal of plant research, 2011, 124(4): 455-465.

Structured Information