Difference between revisions of "Os10g0573400"

From RiceWiki
Jump to: navigation, search
(References)
(Labs working on this gene)
 
(39 intermediate revisions by 5 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os10g0573400''''' was reported as '''''OsPYL''''' in 2012 <ref name="ref1" /> by researchers from Korea.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
[[File:wz1.jpg|327px|thumb|right]]
 +
===Gene Symbol===
 +
*'''''Os02g0187800''''' '''''<=>''''' '''''OsPYL/RCAR10, OsPYL1, OsPYL10, PYL1, PYL10'''''
 +
 
===Function===
 
===Function===
Please input function information here.
+
* '''''OsPYL''''' is a positive regulator of the ABA signal transduction pathway in seed germination and early seedling growth
 +
* Abscisic acid (ABA) is a phytohormone that positively regulates seed dormancy and stress tolerance.<ref name="ref1" /><ref name="ref2" /><ref name="ref3" />
  
This gene possesses most of the key protein functions of ABA-related genes and it is the common ancestor of many species such as ''A. thaliana'', ''Arabidopsis lyrata'', ''Populustrichocarpa'', ''Oryza sativa'', ''Selaginella moellendorffii'', and ''Physcomitrella patens''. In two species (''A. thaliana'' and ''O. sativa''), duplicate genes related to ABA signaling pathways contribute to the expression variation in different organs or stress responses.[[1]] Twelve ABA receptor orthologs named OsPYL1–12 in Oryza sativa (OsPYLs) are identified. OsPYL1 corresponds to Os10g0573400 which is showed in the following chaters.[[2]]
+
===Phenotypic analysis===
 +
* Transgenic rice plants expressing OsPYL/RCAR5, a PYL/RCAR orthologue of rice, were found to be hypersensitive to ABA during seed germination and early seedling growth.
 +
* Constitutive expression of OsPYL/RCAR5 increases expression of the ABA-responsive genes under ABA treatment
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
* This gene is related to the expression of ABA metabolism and its signaling pathways.  
 +
* Proteins related to ABA signaling pathways may have a higher expression variation among different organs or stress responses in comparison with those of ABA metabolism. <ref name="ref2" />
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
* It is the common ancestor of many species such as ''A. thaliana'', ''Arabidopsis lyrata'', ''Populustrichocarpa'', ''Oryza sativa'', ''Selaginella moellendorffii'', and ''Physcomitrella patens''.
 +
* Twelve ABA receptor orthologs named OsPYL1–12 in Oryza sativa (OsPYLs) are identified. OsPYL1 corresponds to Os10g0573400 which is showed in the following chaters. <ref name="ref3" />
  
You can also add sub-section(s) at will.
+
* Phylogenetic relationships in orthologous cluster 7 including ABA receptor genes. An orthologous cluster (OC) is defined to have genes diverged in each species from a gene in the common ancestor of these six species.   <ref name="ref2" />
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* Department of Bio-crop development, National Academy of Agricultural Science, Rural Development Administration, Suwon,441-707 Korea
 +
* Department of Biological Sciences, Sungkyunkwan University, Suwon, 440-746 Korea
 +
* Department of Genetic Engineering, Sungkyunkwan University, Suwon, 440-746 Korea
 +
* School of Biological Sciences (BK21 program), Chung-Ang University, Seoul, 156-756 Korea
  
 
==References==
 
==References==
Please input cited references here.
 
  
Hanada K, Hase T, Toyoda T, et al. Origin and evolution of genes related to ABA metabolism and its signaling pathways[J]. Journal of plant research, 2011, 124(4): 455-465.
+
<references>
 +
<ref name="ref1">
 +
Kim H, Hwang H, Hong JW, Lee YN, Ahn IP, Yoon IS, Yoo SD, Lee S, Lee SC, Kim
 +
BG. A rice orthologue of the ABA receptor, OsPYL/RCAR5, is a positive regulator
 +
of the ABA signal transduction pathway in seed germination and early seedling
 +
growth. J Exp Bot. 2012 Jan;63(2):1013-24. doi: 10.1093/jxb/err338. Epub 2011 Nov
 +
9. PubMed PMID: 22071266.</ref>
  
He Y, Hao Q, Li W, et al. Identification and Characterization of ABA Receptors in Oryza sativa[J]. PloS one, 2014, 9(4): e95246.
+
<ref name="ref2">He Y, Hao Q, Li W, et al. Identification and Characterization of ABA Receptors in Oryza sativa[J]. PloS one, 2014, 9(4): e95246.</ref>
  
==Structured Information==
+
<ref name="ref3">Hanada K, Hase T, Toyoda T, et al. Origin and evolution of genes related to ABA metabolism and its signaling pathways[J]. Journal of plant research, 2011, 124(4): 455-465.</ref>
{{JaponicaGene|
+
</references>
GeneName = Os10g0573400|
 
Description = Conserved hypothetical protein|
 
Version = NM_001072002.1 GI:115483599 GeneID:4349472|
 
Length = 1089 bp|
 
Definition = Oryza sativa Japonica Group Os10g0573400, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|Hanada K, Hase T, Toyoda T, et al. Origin and evolution of genes related to ABA metabolism and its signaling pathways[J]. Journal of plant research, 2011, 124(4): 455-465.
 
Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|
 
AP = Chromosome 10:23221607..23222695|
 
CDS = 23221741..23222379|
 
GCID = <gbrowseImage1>
 
name=NC_008403:23221607..23222695
 
source=RiceChromosome10
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008403:23221607..23222695
 
source=RiceChromosome10
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggagcagcaggaggaagtgccaccgccgccggcggggctggggctgacggcggaggagtacgcgcaggtgcgggcgacggtggaggcgcaccaccgctacgccgtggggccgggccaatgctcctccctcctcgcgcagcgcatccacgcgccgcccgccgccgtctgggccgtcgtccgccgcttcgactgcccccaggtgtacaagcacttcatccgcagctgcgtcctccggcccgacccccaccacgacgacaacggcaacgacctccgccccggccgcctccgcgaggtcagcgtcatctccggcctccccgccagcaccagcaccgagcgcctcgacctcctcgacgacgcccaccgcgtcttcggcttcaccatcaccggcggcgagcaccgcctccgcaactaccgatccgtcaccaccgtctcccagctcgacgagatctgcaccctcgtcctcgagtcctacatcgtcgacgtccccgacggcaacaccgaggacgacacccgcctcttcgccgacaccgtcatcaggctcaacctccagaagctcaagtccgtctccgaggccaacgccaacgccgctgccgccgccgccgctcctcctcctcctccaccggcggcggcggaatag</cdnaseq>|
 
AA = <aaseq>MEQQEEVPPPPAGLGLTAEEYAQVRATVEAHHRYAVGPGQCSSL                    LAQRIHAPPAAVWAVVRRFDCPQVYKHFIRSCVLRPDPHHDDNGNDLRPGRLREVSVI                    SGLPASTSTERLDLLDDAHRVFGFTITGGEHRLRNYRSVTTVSQLDEICTLVLESYIV                    DVPDGNTEDDTRLFADTVIRLNLQKLKSVSEANANAAAAAAAPPPPPPAAAE</aaseq>|
 
DNA = <dnaseqindica>135..773#aaatcccaattccccatctggctcgctcgacatcttcttcactcctcacttcccccactttctctactcctagcatagcagcctcactttccctcctcgatcgaagcagcaggcggaggcggaggggatcggcgatggagcagcaggaggaagtgccaccgccgccggcggggctggggctgacggcggaggagtacgcgcaggtgcgggcgacggtggaggcgcaccaccgctacgccgtggggccgggccaatgctcctccctcctcgcgcagcgcatccacgcgccgcccgccgccgtctgggccgtcgtccgccgcttcgactgcccccaggtgtacaagcacttcatccgcagctgcgtcctccggcccgacccccaccacgacgacaacggcaacgacctccgccccggccgcctccgcgaggtcagcgtcatctccggcctccccgccagcaccagcaccgagcgcctcgacctcctcgacgacgcccaccgcgtcttcggcttcaccatcaccggcggcgagcaccgcctccgcaactaccgatccgtcaccaccgtctcccagctcgacgagatctgcaccctcgtcctcgagtcctacatcgtcgacgtccccgacggcaacaccgaggacgacacccgcctcttcgccgacaccgtcatcaggctcaacctccagaagctcaagtccgtctccgaggccaacgccaacgccgctgccgccgccgccgctcctcctcctcctccaccggcggcggcggaatagcctttttcttttctttttggacctctctgcaatttcacttctattcagggaggtgcttcgaatttgctccatgtctcatgaagttggaggaggaagggtcagcttctaatacatctcattcctggtggtgctgcctgtaataatctcttcatcttcttttttcctctcctcctcctcttctcttcctggatttcttttgcttggaatttttacttacctttgtgtgtgtgtctcacttcctgattggaatccatatttgcttttcggtggttttgttcttcattcaaattcaaattaatctatctagcatttgttc</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001072002.1 RefSeq:Os10g0573400]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]
Line 63: Line 51:
 
[[Category:Japonica Chromosome 10]]
 
[[Category:Japonica Chromosome 10]]
 
[[Category:Chromosome 10]]
 
[[Category:Chromosome 10]]
 +
==Structured Information==

Latest revision as of 02:27, 7 May 2017

The rice Os10g0573400 was reported as OsPYL in 2012 [1] by researchers from Korea.

Annotated Information

Wz1.jpg

Gene Symbol

  • Os02g0187800 <=> OsPYL/RCAR10, OsPYL1, OsPYL10, PYL1, PYL10

Function

  • OsPYL is a positive regulator of the ABA signal transduction pathway in seed germination and early seedling growth
  • Abscisic acid (ABA) is a phytohormone that positively regulates seed dormancy and stress tolerance.[1][2][3]

Phenotypic analysis

  • Transgenic rice plants expressing OsPYL/RCAR5, a PYL/RCAR orthologue of rice, were found to be hypersensitive to ABA during seed germination and early seedling growth.
  • Constitutive expression of OsPYL/RCAR5 increases expression of the ABA-responsive genes under ABA treatment

Expression

  • This gene is related to the expression of ABA metabolism and its signaling pathways.
  • Proteins related to ABA signaling pathways may have a higher expression variation among different organs or stress responses in comparison with those of ABA metabolism. [2]

Evolution

  • It is the common ancestor of many species such as A. thaliana, Arabidopsis lyrata, Populustrichocarpa, Oryza sativa, Selaginella moellendorffii, and Physcomitrella patens.
  • Twelve ABA receptor orthologs named OsPYL1–12 in Oryza sativa (OsPYLs) are identified. OsPYL1 corresponds to Os10g0573400 which is showed in the following chaters. [3]
  • Phylogenetic relationships in orthologous cluster 7 including ABA receptor genes. An orthologous cluster (OC) is defined to have genes diverged in each species from a gene in the common ancestor of these six species. [2]

Labs working on this gene

  • Department of Bio-crop development, National Academy of Agricultural Science, Rural Development Administration, Suwon,441-707 Korea
  • Department of Biological Sciences, Sungkyunkwan University, Suwon, 440-746 Korea
  • Department of Genetic Engineering, Sungkyunkwan University, Suwon, 440-746 Korea
  • School of Biological Sciences (BK21 program), Chung-Ang University, Seoul, 156-756 Korea

References

  1. 1.0 1.1 Kim H, Hwang H, Hong JW, Lee YN, Ahn IP, Yoon IS, Yoo SD, Lee S, Lee SC, Kim BG. A rice orthologue of the ABA receptor, OsPYL/RCAR5, is a positive regulator of the ABA signal transduction pathway in seed germination and early seedling growth. J Exp Bot. 2012 Jan;63(2):1013-24. doi: 10.1093/jxb/err338. Epub 2011 Nov 9. PubMed PMID: 22071266.
  2. 2.0 2.1 2.2 He Y, Hao Q, Li W, et al. Identification and Characterization of ABA Receptors in Oryza sativa[J]. PloS one, 2014, 9(4): e95246.
  3. 3.0 3.1 Hanada K, Hase T, Toyoda T, et al. Origin and evolution of genes related to ABA metabolism and its signaling pathways[J]. Journal of plant research, 2011, 124(4): 455-465.

Structured Information