Difference between revisions of "Os06g0127100"

From RiceWiki
Jump to: navigation, search
(Expression)
 
(12 intermediate revisions by 4 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os06g0127100''''' was reported as '''''OsDREB1C''''' in 2006 <ref name="ref1" /> by researchers from Japan.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
[[File: li-Os06g0127100-Fig1.jpg|right|thumb|300px]]
 +
===Gene Symbol===
 +
*'''''Os06g0127100''''' '''''<=>''''' '''''OsDREB1C, CBF1, ERF26, OsERF026, OsERF#026, OsERF26, AP2/EREBP#098, AP2/EREBP98'''''
 +
 
===Function===
 
===Function===
It comprises a large group of plantspecific transcription factors and is involved in abiotic stress response.It is highly up-regulated in both
+
*  OsDREB1C is member of ERF transcription factors and is involved in abiotic stress response.
genotypes, which is consistent with previous reports that these DREBs/CBFs contribute to low temperature stress response by regulating many transcriptomic and metabolic changes.
 
 
===Expression===
 
===Expression===
In the vegetative organs, the transcripts of the gene are found most abundant in the roots followed by the leaf and stem; whereas, in reproductive tissues,the gene expression is observed high in the embryo and lemma.It comprises a large group of plantspecific transcription factors and is involved in abiotic stress response.
+
* In the vegetative organs, the transcripts of the gene are found most abundant in the roots followed by the leaf and stem; whereas, in reproductive tissues,the gene expression is observed high in the embryo and lemma.
  
===Evolution===
 
Please input evolution information here.
 
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
 +
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* Biological Resources Division, Japan International Research Center for Agricultural Sciences (JIRCAS), Tsukuba, Ibaraki, 305-8686 Japan
 +
* Laboratory of Plant Molecular Biology, RIKEN Tsukuba Institute, Tsukuba, Ibaraki, 305-0074 Japan
 +
* Experimental Plant Division, BioResource Center, RIKEN Tsukuba Institute, Tsukuba, Ibaraki, 305-0074 Japan
 +
* Core Research for Evolutional Science and Technology (CREST), Japan Science and Technology Agency, Kawaguchi, Saitama, 332-0012 Japan
 +
* Graduate School of Agricultural and Life Sciences, The University of Tokyo, Bunkyo, Tokyo, 113-8657 Japan
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Ito Y, Katsura K, Maruyama K, Taji T, Kobayashi M, Seki M, Shinozaki K,
 +
Yamaguchi-Shinozaki K. Functional analysis of rice DREB1/CBF-type transcription
 +
factors involved in cold-responsive gene expression in transgenic rice. Plant
 +
Cell Physiol. 2006 Jan;47(1):141-53. PubMed PMID: 16284406.
 +
</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os06g0127100|
 
Description = Similar to CBF-like protein|
 
Version = NM_001063196.1 GI:115466123 GeneID:4339974|
 
Length = 764 bp|
 
Definition = Oryza sativa Japonica Group Os06g0127100, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|
 
AP = Chromosome 6:1433771..1434534|
 
CDS = 1433798..1434442|
 
GCID = <gbrowseImage1>
 
name=NC_008399:1433771..1434534
 
source=RiceChromosome06
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008399:1433771..1434534
 
source=RiceChromosome06
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggagtactacgagcaggaggagtacgcgacggtgacgtcggcgccgccgaagcggccggcggggaggaccaagttcagggagacgaggcacccggtgtaccgcggcgtgcggcggcgggggcccgcggggcggtgggtgtgcgaggtcagggagcccaacaagaagtcccgcatctggctcggcaccttcgccaccgccgaggccgccgcgcgcgcccacgacgtcgccgcgctcgccctccgcggccgcggcgcgtgcctcaacttcgccgactcggcccgcctcctccgcgtcgacccggccaccctcgccacccccgacgacatccgccgcgccgccatcgagctcgccgagtcatgcccgcacgacgccgccgccgccgccgcctccagctccgccgccgccgtcgaggcctccgccgccgccgcgcccgccatgatgatgcagtaccaggacgacatggcggcgacgccgtccagctacgactacgcgtactacggcaacatggacttcgaccagccgtcctactactacgacgggatgggcggcggcggcgagtaccagagctggcagatggacggcgacgacgatggtggcgccggcggctacggcggcggcgacgtcacactctggagctactga</cdnaseq>|
 
AA = <aaseq>MEYYEQEEYATVTSAPPKRPAGRTKFRETRHPVYRGVRRRGPAG                    RWVCEVREPNKKSRIWLGTFATAEAAARAHDVAALALRGRGACLNFADSARLLRVDPA                    TLATPDDIRRAAIELAESCPHDAAAAAASSSAAAVEASAAAAPAMMMQYQDDMAATPS                    SYDYAYYGNMDFDQPSYYYDGMGGGGEYQSWQMDGDDDGGAGGYGGGDVTLWSY</aaseq>|
 
DNA = <dnaseqindica>28..672#ccagcagcagcaacacacactactgacatggagtactacgagcaggaggagtacgcgacggtgacgtcggcgccgccgaagcggccggcggggaggaccaagttcagggagacgaggcacccggtgtaccgcggcgtgcggcggcgggggcccgcggggcggtgggtgtgcgaggtcagggagcccaacaagaagtcccgcatctggctcggcaccttcgccaccgccgaggccgccgcgcgcgcccacgacgtcgccgcgctcgccctccgcggccgcggcgcgtgcctcaacttcgccgactcggcccgcctcctccgcgtcgacccggccaccctcgccacccccgacgacatccgccgcgccgccatcgagctcgccgagtcatgcccgcacgacgccgccgccgccgccgcctccagctccgccgccgccgtcgaggcctccgccgccgccgcgcccgccatgatgatgcagtaccaggacgacatggcggcgacgccgtccagctacgactacgcgtactacggcaacatggacttcgaccagccgtcctactactacgacgggatgggcggcggcggcgagtaccagagctggcagatggacggcgacgacgatggtggcgccggcggctacggcggcggcgacgtcacactctggagctactgatgatcgcgagttggagctagcagttttgagctcaaccagctttgctcctcctatacagctaaatactgtaggagaaattaatggagattttt</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063196.1 RefSeq:Os06g0127100]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 02:29, 7 May 2017

The rice Os06g0127100 was reported as OsDREB1C in 2006 [1] by researchers from Japan.

Annotated Information

Li-Os06g0127100-Fig1.jpg

Gene Symbol

  • Os06g0127100 <=> OsDREB1C, CBF1, ERF26, OsERF026, OsERF#026, OsERF26, AP2/EREBP#098, AP2/EREBP98

Function

  • OsDREB1C is member of ERF transcription factors and is involved in abiotic stress response.

Expression

  • In the vegetative organs, the transcripts of the gene are found most abundant in the roots followed by the leaf and stem; whereas, in reproductive tissues,the gene expression is observed high in the embryo and lemma.


You can also add sub-section(s) at will.


Labs working on this gene

  • Biological Resources Division, Japan International Research Center for Agricultural Sciences (JIRCAS), Tsukuba, Ibaraki, 305-8686 Japan
  • Laboratory of Plant Molecular Biology, RIKEN Tsukuba Institute, Tsukuba, Ibaraki, 305-0074 Japan
  • Experimental Plant Division, BioResource Center, RIKEN Tsukuba Institute, Tsukuba, Ibaraki, 305-0074 Japan
  • Core Research for Evolutional Science and Technology (CREST), Japan Science and Technology Agency, Kawaguchi, Saitama, 332-0012 Japan
  • Graduate School of Agricultural and Life Sciences, The University of Tokyo, Bunkyo, Tokyo, 113-8657 Japan

References

  1. Ito Y, Katsura K, Maruyama K, Taji T, Kobayashi M, Seki M, Shinozaki K, Yamaguchi-Shinozaki K. Functional analysis of rice DREB1/CBF-type transcription factors involved in cold-responsive gene expression in transgenic rice. Plant Cell Physiol. 2006 Jan;47(1):141-53. PubMed PMID: 16284406.

Structured Information