Difference between revisions of "Os06g0127100"

From RiceWiki
Jump to: navigation, search
(References)
 
(3 intermediate revisions by 3 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os06g0127100''''' was reported as '''''OsDREB1C''''' in 2006 <ref name="ref1" /> by researchers from Japan.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
[[File: li-Os06g0127100-Fig1.jpg|right|thumb|300px]]
 +
===Gene Symbol===
 +
*'''''Os06g0127100''''' '''''<=>''''' '''''OsDREB1C, CBF1, ERF26, OsERF026, OsERF#026, OsERF26, AP2/EREBP#098, AP2/EREBP98'''''
 +
 
===Function===
 
===Function===
 
+
*  OsDREB1C is member of ERF transcription factors and is involved in abiotic stress response.
Conserved amino acid residues and phylogeny construction using the AP2/ERF conserved domain sequence suggest that in rice the OsAP2/EREBP gene family can be classified broadly into four subfamilies [AP2, RAV (related to ABI3/VP1), DREB(dehydration-responsive element-binding protein) and ERF (ethylene-responsive factor)](Akhter Most Sharoni, 2010).The chromosomal localizations of the OsAP2/EREBP genes indicated 20 segmental duplication events involving 40 genes; 58 redundant OsAP2/EREBP genes were involved in tandem duplication events(Akhter Most Sharoni, 2010). Os06g0127100 comprises a large group of plantspecific transcription factors and is involved in abiotic stress response.It is highly up-regulated in both genotypes, which is consistent with previous reports that these DREBs/CBFs contribute to low temperature stress response by regulating many transcriptomic and metabolic changes(Zhang, 2012).
 
 
 
 
===Expression===
 
===Expression===
 +
* In the vegetative organs, the transcripts of the gene are found most abundant in the roots followed by the leaf and stem; whereas, in reproductive tissues,the gene expression is observed high in the embryo and lemma.
  
In the vegetative organs, the transcripts of the gene are found most abundant in the roots followed by the leaf and stem; whereas, in reproductive tissues,the gene expression is observed high in the embryo and lemma.It comprises a large group of plantspecific transcription factors and is involved in abiotic stress response(Muhammad rashid, 2012).
 
Relationships among rice AP2/EREBP proteins after alignment with ClustalW. OsAP2/EREBP proteins were allocated to two distinct subfamilies (DREB, subgroups A-1 to A-6; ERF, subgroups B-1 to B-7).
 
[[File: li-Os06g0127100-Fig1.jpg|right|thumb|200px|''Fig1.Relationships among rice AP2/EREBP proteins after alignment with ClustalW. OsAP2/EREBP proteins were allocated to two distinct subfamilies (DREB, subgroups A-1 to A-6; ERF, subgroups B-1 to B-7). (from reference <ref name="Akhter Most Sharoni" />).'']]
 
 
===Evolution===
 
Please input evolution information here.
 
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
  
[[File: Li-Os06g0127100-Fig2.jpg|right|thumb|200px|(A) Evolutionary relationships among rice AP2/EREBP domain sequences. The unrooted tree was generated by the Neighbor–Joiningmethod with the ClustalX program. Domains a and b were found in subfamilies RAV and AP2, e.g. in Os01g59780a and Os01g59780b, respectively.The RAV subfamily showed motif duplication, and the AP2 subfamily showed domain duplication. (B) Structure of AP2/EREBP genes (from reference <ref name="Akhter Most Sharoni" />).'']]
 
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* Biological Resources Division, Japan International Research Center for Agricultural Sciences (JIRCAS), Tsukuba, Ibaraki, 305-8686 Japan
 
+
* Laboratory of Plant Molecular Biology, RIKEN Tsukuba Institute, Tsukuba, Ibaraki, 305-0074 Japan
Conceived and designed the experiments: BF DY. Performed the experiments: TZ XZ WW YP LH XL LZ. Analyzed the data: TZ BF. Contributed reagents/materials/analysis tools: LZ YZ. Wrote the paper:BF TZ DY.
+
* Experimental Plant Division, BioResource Center, RIKEN Tsukuba Institute, Tsukuba, Ibaraki, 305-0074 Japan
 +
* Core Research for Evolutional Science and Technology (CREST), Japan Science and Technology Agency, Kawaguchi, Saitama, 332-0012 Japan
 +
* Graduate School of Agricultural and Life Sciences, The University of Tokyo, Bunkyo, Tokyo, 113-8657 Japan
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 
+
* <ref name="ref1">
1. Sharoni Akhter Most, Nuruzzaman Mohammed, Satoh Kouji, Shimizu Takumi, Kondoh Hiroaki, Sasaya Takahide, Choi Il-Ryong, Omura Toshihiro,  Kikuchi Shoshi. Gene Structures Classification Expression Models of the AP2 EREBP Transcription Factor Family in Rice[J]. Plant and Cell Physiology , 2010-2 .
+
Ito Y, Katsura K, Maruyama K, Taji T, Kobayashi M, Seki M, Shinozaki K,
 
+
Yamaguchi-Shinozaki K. Functional analysis of rice DREB1/CBF-type transcription
2. Zhang Ting, Zhao Xiuqin, Wang Wensheng, Pan Yajiao, Huang Liyu, Liu Xiaoyue, Zong Ying, Zhu Linghua, Yang Daichang, Fu Binying. Comparative Transcriptome Profiling of Chilling Stress Responsiveness in Two Contrasting Rice Genotypes[J], 2012-8.
+
factors involved in cold-responsive gene expression in transgenic rice. Plant
 
+
Cell Physiol. 2006 Jan;47(1):141-53. PubMed PMID: 16284406.
3. Rashid M, Guangyuan H, Guangxiao Y, etal. AP2/ERF Transcription Factor in Rice: Genome-Wide Canvas and Syntenic Relationships between Monocots and Eudicots[J], 2012-6.
+
</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os06g0127100|
 
Description = Similar to CBF-like protein|
 
Version = NM_001063196.1 GI:115466123 GeneID:4339974|
 
Length = 764 bp|
 
Definition = Oryza sativa Japonica Group Os06g0127100, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|
 
AP = Chromosome 6:1433771..1434534|
 
CDS = 1433798..1434442|
 
GCID = <gbrowseImage1>
 
name=NC_008399:1433771..1434534
 
source=RiceChromosome06
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008399:1433771..1434534
 
source=RiceChromosome06
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggagtactacgagcaggaggagtacgcgacggtgacgtcggcgccgccgaagcggccggcggggaggaccaagttcagggagacgaggcacccggtgtaccgcggcgtgcggcggcgggggcccgcggggcggtgggtgtgcgaggtcagggagcccaacaagaagtcccgcatctggctcggcaccttcgccaccgccgaggccgccgcgcgcgcccacgacgtcgccgcgctcgccctccgcggccgcggcgcgtgcctcaacttcgccgactcggcccgcctcctccgcgtcgacccggccaccctcgccacccccgacgacatccgccgcgccgccatcgagctcgccgagtcatgcccgcacgacgccgccgccgccgccgcctccagctccgccgccgccgtcgaggcctccgccgccgccgcgcccgccatgatgatgcagtaccaggacgacatggcggcgacgccgtccagctacgactacgcgtactacggcaacatggacttcgaccagccgtcctactactacgacgggatgggcggcggcggcgagtaccagagctggcagatggacggcgacgacgatggtggcgccggcggctacggcggcggcgacgtcacactctggagctactga</cdnaseq>|
 
AA = <aaseq>MEYYEQEEYATVTSAPPKRPAGRTKFRETRHPVYRGVRRRGPAG                    RWVCEVREPNKKSRIWLGTFATAEAAARAHDVAALALRGRGACLNFADSARLLRVDPA                    TLATPDDIRRAAIELAESCPHDAAAAAASSSAAAVEASAAAAPAMMMQYQDDMAATPS                    SYDYAYYGNMDFDQPSYYYDGMGGGGEYQSWQMDGDDDGGAGGYGGGDVTLWSY</aaseq>|
 
DNA = <dnaseqindica>28..672#ccagcagcagcaacacacactactgacatggagtactacgagcaggaggagtacgcgacggtgacgtcggcgccgccgaagcggccggcggggaggaccaagttcagggagacgaggcacccggtgtaccgcggcgtgcggcggcgggggcccgcggggcggtgggtgtgcgaggtcagggagcccaacaagaagtcccgcatctggctcggcaccttcgccaccgccgaggccgccgcgcgcgcccacgacgtcgccgcgctcgccctccgcggccgcggcgcgtgcctcaacttcgccgactcggcccgcctcctccgcgtcgacccggccaccctcgccacccccgacgacatccgccgcgccgccatcgagctcgccgagtcatgcccgcacgacgccgccgccgccgccgcctccagctccgccgccgccgtcgaggcctccgccgccgccgcgcccgccatgatgatgcagtaccaggacgacatggcggcgacgccgtccagctacgactacgcgtactacggcaacatggacttcgaccagccgtcctactactacgacgggatgggcggcggcggcgagtaccagagctggcagatggacggcgacgacgatggtggcgccggcggctacggcggcggcgacgtcacactctggagctactgatgatcgcgagttggagctagcagttttgagctcaaccagctttgctcctcctatacagctaaatactgtaggagaaattaatggagattttt</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063196.1 RefSeq:Os06g0127100]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 02:29, 7 May 2017

The rice Os06g0127100 was reported as OsDREB1C in 2006 [1] by researchers from Japan.

Annotated Information

Li-Os06g0127100-Fig1.jpg

Gene Symbol

  • Os06g0127100 <=> OsDREB1C, CBF1, ERF26, OsERF026, OsERF#026, OsERF26, AP2/EREBP#098, AP2/EREBP98

Function

  • OsDREB1C is member of ERF transcription factors and is involved in abiotic stress response.

Expression

  • In the vegetative organs, the transcripts of the gene are found most abundant in the roots followed by the leaf and stem; whereas, in reproductive tissues,the gene expression is observed high in the embryo and lemma.


You can also add sub-section(s) at will.


Labs working on this gene

  • Biological Resources Division, Japan International Research Center for Agricultural Sciences (JIRCAS), Tsukuba, Ibaraki, 305-8686 Japan
  • Laboratory of Plant Molecular Biology, RIKEN Tsukuba Institute, Tsukuba, Ibaraki, 305-0074 Japan
  • Experimental Plant Division, BioResource Center, RIKEN Tsukuba Institute, Tsukuba, Ibaraki, 305-0074 Japan
  • Core Research for Evolutional Science and Technology (CREST), Japan Science and Technology Agency, Kawaguchi, Saitama, 332-0012 Japan
  • Graduate School of Agricultural and Life Sciences, The University of Tokyo, Bunkyo, Tokyo, 113-8657 Japan

References

  1. Ito Y, Katsura K, Maruyama K, Taji T, Kobayashi M, Seki M, Shinozaki K, Yamaguchi-Shinozaki K. Functional analysis of rice DREB1/CBF-type transcription factors involved in cold-responsive gene expression in transgenic rice. Plant Cell Physiol. 2006 Jan;47(1):141-53. PubMed PMID: 16284406.

Structured Information