|
|
| (6 intermediate revisions by 3 users not shown) |
| Line 1: |
Line 1: |
| − | Gene Os11g0523700,namely OsICE1, is Inducer of CBF Expression 1 and involved in cold acclimation.
| + | The rice '''''Os11g0523700''''' was reported as '''''OsICE1''''' in 2011 <ref name="ref1" /> by researchers from Japan. |
| | | | |
| | ==Annotated Information== | | ==Annotated Information== |
| | + | [[File:Os11g0523700.png|right|thumb|327px|'''Figure 2.'''<ref name="ref1" />.'']] |
| | + | ===Gene Symbol=== |
| | + | *'''''Os11g0523700''''' '''''<=>''''' '''''ICE1, OsICE1, OsbHLH002''''' |
| | + | |
| | ===Function=== | | ===Function=== |
| − | This gene encodes a inducer of CBF expression 1 named ''OsICE1''.Cold stress on crops results in severe yield losses through growth retardation and irreversible damage. Recently, Inducer of CBF Expression 1 (ICE1) was identified as the master regulator inducing dehydration responsive element binding protein/C-repeat binding factor (DREB/CBF)-type transcriptional factors involved in the signaling of cold and osmotic stress in Arabidopsis. Chilling stress on rice seedlings induced two ICE-related proteins with molecular masses of approximately 55 and 40 kDa. ''OsICE'' homologs function in transcriptional regulation at upstream of a cold-stress-induced transcription factor cascade involving ''OsDREB1B'' and ''OsHsfA3'', leading to cold acclimation, possibly involving trehalose synthesis.<ref name="ref1" />
| + | * The rice OsICE1 function in transcriptional regulation at upstream of a cold-stress-induced transcription factor cascade involving OsDREB1B and OsHsfA3, leading to cold acclimation, possibly involving trehalose synthesis<ref name="ref1" /> |
| − | | |
| | | | |
| | ===Expression=== | | ===Expression=== |
| − | Cold stress had little or no effect on the expression of ''OsICE1'' and ''OsICE2''. Semi-quantitative RT-PCR indicated that both were constantly expressed, but that cold stress sequentially upregulated OsDREB1B, rice heat shock factor A3 (OsHsfA3), and trehalose-6-phosphate phosphatase (OsTPP1). Trehalose treatment enhanced the cold tolerance of seedlings.<ref name="ref1" /> | + | * Cold stress had little or no effect on the expression of ''OsICE1'' and ''OsICE2''. |
| − | | + | * Semi-quantitative RT-PCR indicated that both were constantly expressed, but that cold stress sequentially upregulated OsDREB1B, rice heat shock factor A3 (OsHsfA3), and trehalose-6-phosphate phosphatase (OsTPP1).<ref name="ref1" /> |
| − | | |
| − | ===Evolution===
| |
| − | Cold stress on crops results in severe yield losses through growth retardation and irreversible damage. Recently, Inducer of CBF Expression 1 (ICE1) was identified as the master regulator inducing dehydration responsive element binding protein/C-repeat binding factor (DREB/CBF)-type transcriptional factors involved in the signaling of cold and osmotic stress in Arabidopsis. To examine whether rice ICE homologs function in cold acclimation via regulation of rice DREB homologs in response to cold stress, we assessed a polypeptide epitope containing an ICE-specific motif. Chilling stress on rice seedlings induced two ICE-related proteins with molecular masses of approximately 55 and 40 kDa. These sizes are consistent with those predicted for OsICE1 and OsICE2, respectively. In contrast to the proteins, cold stress had little or no effect on the expression of OsICE1 and OsICE2. Semi-quantitative RT-PCR indicated that both were constantly expressed, but that cold stress sequentially upregulated OsDREB1B, rice heat shock factor A3 (OsHsfA3), and trehalose-6-phosphate phosphatase (OsTPP1). Trehalose treatment enhanced the cold tolerance of seedlings. These results suggest that OsICE homologs function in transcriptional regulation at upstream of a cold-stress-induced transcription factor cascade involving OsDREB1B and OsHsfA3, leading to cold acclimation, possibly involving trehalose synthesis.<ref name="ref1" />
| |
| | | | |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| | | | |
| − | *Graduate School of Bioresource and Bioenvironmental Sciences, Kyushu University, Fukuoka 812-8581, Japan; | + | *Graduate School of Bioresource and Bioenvironmental Sciences, Kyushu University, Fukuoka 812-8581, Japan |
| | | | |
| − | *Department of Bioresource Sciences, Faculty of Agriculture, Kyushu University, Fukuoka 812-8581, Japan; | + | *Department of Bioresource Sciences, Faculty of Agriculture, Kyushu University, Fukuoka 812-8581, Japan |
| | | | |
| | *School of Agriculture, Kyushu University, Fukuoka 812-8581, Japan | | *School of Agriculture, Kyushu University, Fukuoka 812-8581, Japan |
| | | | |
| | ==References== | | ==References== |
| − | | + | <references> |
| − | 1. Junya Nakamura;Takashi Yuasa;Tran Thi Huong;Keisuke Harano;Sho Tanaka;Tomoe Iwata;Thuy Phan;Mari Iwaya. Rice homologs of inducer of CBF expression (OsICE) are involved in cold acclimation. Plant Biotechnology, 2011, 28(3): 303-309
| + | <ref name="ref1">Junya Nakamura;Takashi Yuasa;Tran Thi Huong;Keisuke Harano;Sho Tanaka;Tomoe Iwata;Thuy Phan;Mari Iwaya. Rice homologs of inducer of CBF expression (OsICE) are involved in cold acclimation. Plant Biotechnology, 2011, 28(3): 303-309</ref> |
| | + | </references> |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| |
| − | GeneName = Os11g0523700|
| |
| − | Description = Similar to Transcription factor ICE1 (Inducer of CBF expression 1) (Basic helix- loop-helix protein 116) (bHLH116) (AtbHLH116)|
| |
| − | Version = NM_001074519.2 GI:297611916 GeneID:4350609|
| |
| − | Length = 3209 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os11g0523700, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| | | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|
| |
| − | AP = Chromosome 11:20749846..20753054|
| |
| − | CDS = 20749903..20750994,20751889..20752116,20752352..20752522,20752642..20752725|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008404:20749846..20753054
| |
| − | source=RiceChromosome11
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008404:20749846..20753054
| |
| − | source=RiceChromosome11
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atgctgccgcggtttcacggcgccatgtggatgcaggacgacggcggcggcgaccaagaacacgggcaggcggcgccgcctgggcaggagcagcaccaccacgaccagcatctcatggcgttggcggccgcggccgcgggcggcgccgggttcggcgcggcgcaggcgccggcgccgctgctcgatgaggactggtacttcgacgcggcgggtggtggtggtggtggcgcgcatgggtccatgatgctgggtttgtcgtccgtccatggcgggattggggcggggacgtctggtggtgggcatgggcagcagttctcgctgctcaacatgggcgccgcggccgcgccgttcgacgtctccgggttcgacctcgggatcgcctgcggcggcgttggcggcggcggcgacgtggtgtcgtttcttggcggcgggaacgcgtcgaacaccgcgctgctccccgtcgggaacgcggggttcctcggcacgttcggcgggttcggcaccgcggcgtcccaaatgccggagttcggcgggctcgccgggttcgacatgttcgacgcgggcgccgtgaacaccgggggcagctcctcctcctcgtcggcggcggcggcggcggcgtccgcctcggcgcacgtgagcaacaccgcgccgttctccgggcgcggcaaggcggcggtgctgcggccgctggatatcgtcccgcccgtgggcgcgcagccgacgctgttccagaagcgcgcgctccgccgcaacgccggcgaggacgacgacgacaagaagcgcaaggccgccgcgggcgcgggcgcgggcgcgctgtccgccgacggcgccgacatggtgctcgacgacggcgacgacgacggcctcagcatcgacgcgtcgggcggcctcaactacgactccgaggacgccaggggcggcgaggacagcggcgccaagaaggagtcgaacgccaacagcacggtcaccggcgacgggaaggggaagaagaaggggatgccggccaagaacctcatggcggagcgccgccgccggaagaagctcaacgaccgcctctacatgctccgctccgtcgtgcccaagatcagcaagatggacagggcttccattctcggcgacgcgattgagtacctgaaggagctgctgcagaagatcaatgatcttcagaatgagctcgagtcgtcccccgcgacgtcgtcattgcctccaacacccacaagcttccatcccctgacaccgacgctgcccacattgccgtcccgcatcaaggaagagatctgcccaagtgcattgccaagccccactggacaacagccaagggttgaggttaggctgagggaaggccgggctgtcaatatccacatgttctgtgctcggaggcccggtctactgctctctgccatgagggccgtcgaaggccttggtctcgatgtccagcaagctgtaatcagttgcttcaatggctttacgttggatatttttaaggctgagcaatgcaaggacggccctgggctgttgcctgaagaaatcaaggccgttctgatgcaatccgccgggttccataccatgatctag</cdnaseq>|
| |
| − | AA = <aaseq>MLPRFHGAMWMQDDGGGDQEHGQAAPPGQEQHHHDQHLMALAAA AAGGAGFGAAQAPAPLLDEDWYFDAAGGGGGGAHGSMMLGLSSVHGGIGAGTSGGGHG QQFSLLNMGAAAAPFDVSGFDLGIACGGVGGGGDVVSFLGGGNASNTALLPVGNAGFL GTFGGFGTAASQMPEFGGLAGFDMFDAGAVNTGGSSSSSSAAAAAASASAHVSNTAPF SGRGKAAVLRPLDIVPPVGAQPTLFQKRALRRNAGEDDDDKKRKAAAGAGAGALSADG ADMVLDDGDDDGLSIDASGGLNYDSEDARGGEDSGAKKESNANSTVTGDGKGKKKGMP AKNLMAERRRRKKLNDRLYMLRSVVPKISKMDRASILGDAIEYLKELLQKINDLQNEL ESSPATSSLPPTPTSFHPLTPTLPTLPSRIKEEICPSALPSPTGQQPRVEVRLREGRA VNIHMFCARRPGLLLSAMRAVEGLGLDVQQAVISCFNGFTLDIFKAEQCKDGPGLLPE EIKAVLMQSAGFHTMI</aaseq>|
| |
| − | DNA = <dnaseqindica>58..1149#2044..2271#2507..2677#2797..2880#gcacctctgcatctctgccatctccttccccaccccaccgccattgccgccgcggcgatgctgccgcggtttcacggcgccatgtggatgcaggacgacggcggcggcgaccaagaacacgggcaggcggcgccgcctgggcaggagcagcaccaccacgaccagcatctcatggcgttggcggccgcggccgcgggcggcgccgggttcggcgcggcgcaggcgccggcgccgctgctcgatgaggactggtacttcgacgcggcgggtggtggtggtggtggcgcgcatgggtccatgatgctgggtttgtcgtccgtccatggcgggattggggcggggacgtctggtggtgggcatgggcagcagttctcgctgctcaacatgggcgccgcggccgcgccgttcgacgtctccgggttcgacctcgggatcgcctgcggcggcgttggcggcggcggcgacgtggtgtcgtttcttggcggcgggaacgcgtcgaacaccgcgctgctccccgtcgggaacgcggggttcctcggcacgttcggcgggttcggcaccgcggcgtcccaaatgccggagttcggcgggctcgccgggttcgacatgttcgacgcgggcgccgtgaacaccgggggcagctcctcctcctcgtcggcggcggcggcggcggcgtccgcctcggcgcacgtgagcaacaccgcgccgttctccgggcgcggcaaggcggcggtgctgcggccgctggatatcgtcccgcccgtgggcgcgcagccgacgctgttccagaagcgcgcgctccgccgcaacgccggcgaggacgacgacgacaagaagcgcaaggccgccgcgggcgcgggcgcgggcgcgctgtccgccgacggcgccgacatggtgctcgacgacggcgacgacgacggcctcagcatcgacgcgtcgggcggcctcaactacgactccgaggacgccaggggcggcgaggacagcggcgccaagaaggagtcgaacgccaacagcacggtcaccggcgacgggaaggggaagaagaaggggatgccggccaagaacctcatggcggagcgccgccgccggaagaagctcaacgaccgcctctacatgctccgctccgtcgtgcccaagatcagcaaggtcaggattccttctcctgctctcccaattctcatgaaatctctcaaaaagttcttaattctggcgaattttagggaatgcgtaattttggtcgaattttgtgtgttttctttgccatgaagagtggaaaggggaaaataaattctgtggttagcattgctaccaatattcttgtatgatataagttctacttatgatttgaatttctgaacttcaagtatatgagtttgatgaactatttttcatagccaacggcatgcatttcagttgcgattgttcatgtcaaattgtggatatacaccaactttggaaggattttgtttcatttacagaaattctagcttctagttctatgttctgttaggaactttgattgtctttaggaaggagtagatagaatgacttcaattgtcctagtcgttgctggttacaagaattaaatgtgacttctgttcataagatgtctgcatgggaatttttactgtccatcacactgtcactacctgtctctgctgcctcctgttcagtttccagtcaatcgagtagacttgtagacagattgcagaaaaacaataaaaagccatgccctacataactgtgttttagtttagttttagtagtcagagaatctttcagtattttgttgtataaaaaatgagttgctctattttcttttactaccttttattttgtgttgagacagtgggagagaatgagttagtatactgcactgcatcatctgttatctgttcctgaatactgacattgtttcctttttcacatttcctcttgctggtactactaatatcattcatatgaaagcaattctatagtgatgcattatacttgtgatgatttagcaataagatgattatatgtgtttgcaattggtagatggacagggcttccattctcggcgacgcgattgagtacctgaaggagctgctgcagaagatcaatgatcttcagaatgagctcgagtcgtcccccgcgacgtcgtcattgcctccaacacccacaagcttccatcccctgacaccgacgctgcccacattgccgtcccgcatcaaggaagagatctgcccaagtgcattgccaagccccactggacaacagccaagggtcagtatctcctatcttctgaatgtcaccagatgagagtatagcttgtttcagatgagataacctgcatatcagaaaaggaattgcattgtcattggtataattatgcggttgataagtagtagacagtaaaatgtgcaatgtggttgatttatgcatcagattttctaactattgccaacctgatcaagcatttgacacactttctgacctttttttctacatcttgcaaaaggttgaggttaggctgagggaaggccgggctgtcaatatccacatgttctgtgctcggaggcccggtctactgctctctgccatgagggccgtcgaaggccttggtctcgatgtccagcaagctgtaatcagttgcttcaatggctttacgttggatatttttaaggctgaggtaatgcataaaattctatgctcattttcagaactagcatttcgatatagtatcctgaaggatagtggtgatggtactgaaactcaatttgaactgacaattgctcaattttaatgcagcaatgcaaggacggccctgggctgttgcctgaagaaatcaaggccgttctgatgcaatccgccgggttccataccatgatctaggacaggagagctcaatcaaactccaaaggacagagtagctcaggaattgacaaagtaccggtgtttcctggtcatgtggcattttcgacagaaggaagttcctctttttagtagttttagacctgctcagggcttgctgaaccagtttatcttctagtatttagagtccccaaaaaaaataatgtcagtagtctcttggtgctttaacattgtgttttgaaaccttctgcctgttttttttacttcccggtacatgttttcgtcttgtgtaagtctgaagatgaattcctatcaattaacaggcaaagaaacaggatcattccaagaac</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001074519.2 RefSeq:Os11g0523700]|
| |
| − | }}
| |
| | [[Category:Genes]] | | [[Category:Genes]] |
| | [[Category:Japonica mRNA]] | | [[Category:Japonica mRNA]] |