Difference between revisions of "Os09g0459200"

From RiceWiki
Jump to: navigation, search
(Labs working on this gene)
(Annotated Information)
 
(13 intermediate revisions by 3 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os09g0459200''''' was reported as '''''SG1''''' in 2011 by researchers from Japan.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
[[File:12-Os09g0459200.png|right|thumb|227px|"Figure 1.(from reference<ref name="ref1"/>)."]]
 +
===Gene Symbol===
 +
*'''''Os01g0274800''''' '''''<=>''''' '''''OsSG1, Sg1'''''
 +
 
===Function===
 
===Function===
 +
* SG1, encodes a novel protein that is conserved among angiosperms.
 +
* SHORT GRAIN1 (SG1) controls the elongation of both grains and internodes in rachis branches.
 +
* SG1 decreases organ elongation by decreasing cell proliferation and also decreases responses to BRs and elongation of organs such as seeds and the internodes of rachis branches through decreased cellular proliferation<ref name="ref1"/>
  
 
+
===Phenotypic analysis===
SHORT GRAIN1 (SG1) controls the elongation of both grains and internodes in rachis branches.
+
* Overexpression of '''''SG1''''' in rice produced a phenotype with short grains and dwarfing reminiscent of brassinosteroid (BR)-deficient mutants, with wide, dark-green, and erect leaves.  
Overexpression of SG1 in rice produced a phenotype with short grains and dwarfing reminiscent
+
* However, the endogenous BR level in the SG1 overexpressor (SG1:OX) plants was comparable to the wild type. SG1:OX plants were insensitive to brassinolide in the lamina inclination assay.
of brassinosteroid (BR)-deficient mutants, with wide, dark-green, and erect leaves.SG1 decreases organ elongation by decreasing cell proliferation. SG1 decreases responses
 
to BRs and elongation of organs such as seeds and the internodes of rachis branches through
 
decreased cellular proliferation<ref name="ref1"/>
 
  
 
===Expression===
 
===Expression===
  
During vegetative growth,SG1 was preferentially expressed in the roots. During reproductive growth, SG1 was strongly expressed in the young panicles (0.3–1 cm in length), and expression then gradually decreased as the panicles matured. In the developing panicles, SG1 was expressed most strongly in the spikelets and the basal parts of rachis and rachis branches.
+
* During vegetative growth,SG1 was preferentially expressed in the roots.
SG1 encodes a novel protein that is conserved among angiosperms.SG1 does not share significant identity with any proteins of known function.
+
* During reproductive growth, SG1 was strongly expressed in the young panicles (0.3–1 cm in length), and expression then gradually decreased as the panicles matured.  
However, SG1 and related proteins comprise a family that is conserved among monocots and dicots. The rice genome encodes two SG1-related proteins (Os02g0762600 and Os08g0474100) that have 49% to 53% sequence identity with SG1.
+
* In the developing panicles, SG1 was expressed most strongly in the spikelets and the basal parts of rachis and rachis branches.
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
* SG1 does not share significant identity with any proteins of known function.
 +
* However, SG1 and related proteins comprise a family that is conserved among monocots and dicots. The rice genome encodes two SG1-related proteins (Os02g0762600 and Os08g0474100) that have 49% to 53% sequence identity with SG1.<ref name="ref1" />
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
Line 34: Line 39:
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os09g0459200|
 
Description = Conserved hypothetical protein|
 
Version = NM_001069915.1 GI:115479572 GeneID:4347276|
 
Length = 1474 bp|
 
Definition = Oryza sativa Japonica Group Os09g0459200, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 9|Chromosome 9]]|
 
AP = Chromosome 9:18004651..18006124|
 
CDS = 18004776..18005216,18005552..18005584|
 
GCID = <gbrowseImage1>
 
name=NC_008402:18004651..18006124
 
source=RiceChromosome09
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008402:18004651..18006124
 
source=RiceChromosome09
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggcatgtgttaacatgtacaacccggagcatcaccaccaccagtcgtcgtcgttcatggcgccgaggatatccttttccagcgacttcgcgctcgagccgccgccgccggcgcagcagcagccggcggtgcgggcgcctggggacgccgacttcgagttctccgtcggcagccacccgatgatggccgccgaccagctgatctccaagggccgcctcctgccgctccgggaggccccgcacggccacggcggcgccgacgccggcggccggccactcacgctccgcgacgagctgcgcacggacagccgccatggccgcgtcccccgcgcgcccaacattcggtggaaggagttcctcggcctcaagaaggcgcccaagaaggcccccaccgccgacgctgccgccggcgccacatcgtcgtcggccgacacccagatggatcttggaggtcaagggagcacgagagactga</cdnaseq>|
 
AA = <aaseq>MACVNMYNPEHHHHQSSSFMAPRISFSSDFALEPPPPAQQQPAV                    RAPGDADFEFSVGSHPMMAADQLISKGRLLPLREAPHGHGGADAGGRPLTLRDELRTD                    SRHGRVPRAPNIRWKEFLGLKKAPKKAPTADAAAGATSSSADTQMDLGGQGSTRD</aaseq>|
 
DNA = <dnaseqindica>126..566#902..934#attctccatagcttggccaccgtagtaaagccggcgagctaattctagttctagccagctacacgagatcatcgctgtgacgggcggggcattgagagggcgcgtgtgccggccggggtcgatgcatggcatgtgttaacatgtacaacccggagcatcaccaccaccagtcgtcgtcgttcatggcgccgaggatatccttttccagcgacttcgcgctcgagccgccgccgccggcgcagcagcagccggcggtgcgggcgcctggggacgccgacttcgagttctccgtcggcagccacccgatgatggccgccgaccagctgatctccaagggccgcctcctgccgctccgggaggccccgcacggccacggcggcgccgacgccggcggccggccactcacgctccgcgacgagctgcgcacggacagccgccatggccgcgtcccccgcgcgcccaacattcggtggaaggagttcctcggcctcaagaaggcgcccaagaaggcccccaccgccgacgctgccgccggcgccacatcgtcgtcggccgacacccagatggtaataacaagctcactgtttcttgcgccatgaatgcactctgctacagctctgcattgtcccattttgcttgtcgcattgcaacatttttcgaatcttcaaaaacaccctgcttgctgcaagaccctcctgcgcagtagagtacaagcactttctgcttcaaagatttctcaaagtttggagcctgagatagatgtgcattgcatgcatgtactactcatgcattgctaaccaccagaaccagattgcacagaaattttagcggcacaactactcatgcattgttaaccattttcctgctgaagtgacaacaaaatgtatgcaaaaccctgtaggatcttggaggtcaagggagcacgagagactgaagcaacaaacgcaatgaagtgtattactgatcaatgagtactacgtagtagtgaaactgaagtagccatggttggccagatcggatgcatggtggcgatgcgcctttcagcttgctgtctgccatcactcatattcactcttgctgatgatcttagcagctcattctaatggagaactctgcagggcaaatggccatttccttttacctctttgctgcatcttttttgggtgtaaaagggaattttgatctctagtttttgggtaatggtcgtcgtcgggtagatgggtggttccagtgtagtcaaattaactccgctgcgcctctgatgttttgtattggaagggccagtaaaaatgtatttttccccacatggtgtggtcctagcttagcttttgtacgtgttgtttagctgttcccatgcttgtctgcttccgccacctccgctctctcccccactttccctatgtacaaaaatgcttgtaatctagtagtagctagcaattcaagctttcagttcaatgaagcccatttcaacgtt</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001069915.1 RefSeq:Os09g0459200]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 03:19, 7 May 2017

The rice Os09g0459200 was reported as SG1 in 2011 by researchers from Japan.

Annotated Information

"Figure 1.(from reference[1])."

Gene Symbol

  • Os01g0274800 <=> OsSG1, Sg1

Function

  • SG1, encodes a novel protein that is conserved among angiosperms.
  • SHORT GRAIN1 (SG1) controls the elongation of both grains and internodes in rachis branches.
  • SG1 decreases organ elongation by decreasing cell proliferation and also decreases responses to BRs and elongation of organs such as seeds and the internodes of rachis branches through decreased cellular proliferation[1]

Phenotypic analysis

  • Overexpression of SG1 in rice produced a phenotype with short grains and dwarfing reminiscent of brassinosteroid (BR)-deficient mutants, with wide, dark-green, and erect leaves.
  • However, the endogenous BR level in the SG1 overexpressor (SG1:OX) plants was comparable to the wild type. SG1:OX plants were insensitive to brassinolide in the lamina inclination assay.

Expression

  • During vegetative growth,SG1 was preferentially expressed in the roots.
  • During reproductive growth, SG1 was strongly expressed in the young panicles (0.3–1 cm in length), and expression then gradually decreased as the panicles matured.
  • In the developing panicles, SG1 was expressed most strongly in the spikelets and the basal parts of rachis and rachis branches.

Evolution

  • SG1 does not share significant identity with any proteins of known function.
  • However, SG1 and related proteins comprise a family that is conserved among monocots and dicots. The rice genome encodes two SG1-related proteins (Os02g0762600 and Os08g0474100) that have 49% to 53% sequence identity with SG1.[1]

You can also add sub-section(s) at will.

Labs working on this gene

  • National Institute of Agrobiological Sciences
  • Graduate School of Science and Technology
  • Tokyo University of Science
  • RIKEN Advanced Science Institute

References

  1. 1.0 1.1 1.2 Hitoshi Nakagawa, Atsunori Tanaka, Takanari Tanabata, Miki Ohtake, Shozo Fujioka, et al. short GRAIN1 decreases organ elongation and brassinosteroid response in rice.Plant Physiol 2012 158:1208-19.

Structured Information