Difference between revisions of "Os09g0396900"

From RiceWiki
Jump to: navigation, search
(Labs working on this gene)
(Function)
 
(5 intermediate revisions by 4 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os09g0396900''''' was reported as '''''OsVIT2''''' in 2012 by researchers from China.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os09g0396900''''' '''''<=>''''' '''''OsVIT2,VIT2'''''
 +
 
===Function===
 
===Function===
OsVIT1 and OsVIT2 may function primarily in flag leaves to mediate vacuolar sequestration of Fe and Zn, due to highly expression levels of ''OsVIT1'' and ''OsVIT2'' in flag leaves rather than embryos. And they might also mediate allocation of Fe/Zn between flag leaves and the grains<ref name="ref1" />. Knockdown of the vacuolar Fe transporter gene OsVIT1 or OsVIT2 may be useful to further increase the Fe concentration of seeds <ref name="ref2" />.
+
[[File:OsVIT2.jpg|right|thumb|327px|'''Figure 1.'''Subcellular localization of OsVIT1 and OsVIT2<ref name="ref1" />.]]
 +
 
 +
* OsVIT1 and OsVIT2 may function primarily in flag leaves to mediate vacuolar sequestration of Fe and Zn, due to highly expression levels of ''OsVIT1'' and ''OsVIT2'' in flag leaves rather than embryos.
 +
* And they might also mediate allocation of Fe/Zn between flag leaves and the grains<ref name="ref1" />.
 +
 
 +
===Phenotypic analysis===
 +
* Knockdown of the vacuolar Fe transporter gene OsVIT1 or OsVIT2 may be useful to further increase the Fe concentration of seeds <ref name="ref2" />.
  
 
===Expression===
 
===Expression===
''OsVIT2'' locates in chromosome 9, and encodes putative protein as the vacuolar iron transporter with 247 amino acids which shares 79.8% amino acid similarity with the VIT in ''Arabidopsis''. There are five conserved transmembrane domains in OsVIT2 by further analyses. This gene expresses in flag leaf blades with a significantly high level, but it can also be detected in various tissues/organs including embryos at low levels. Different from ''OsVIT2'', ''OsVIT1'' expresses mainly in flag leaf blades, but also occurs ubiquitously in various tissues/organs including embryos with relatively low levels<ref name="ref1" />. OsVIT2 was quickly induced in rice seedling roots and shoots after the treatment of 4.5 mM FeSO4, but OsVIT1 was not highly induced. Fe starvation caused downregulated ''OsVIT2'' expression in roots and shoots, and no OsVIT1 response until 7 days after treatment in roots. These data suggest that OsVIT1 may represent a housekeeping mechanism for Fe accumulation in vacuoles, while OsVIT2 functions more in response to external Fe levels <ref name="ref1" />.
+
* This gene expresses in flag leaf sheaths with a significantly high level, but it can also be detected in various tissues/organs including embryos at low levels.  
 +
* Different from ''OsVIT2'', ''OsVIT1'' expresses mainly in flag leaf blades, but also occurs ubiquitously in various tissues/organs including embryos with relatively low levels<ref name="ref1" />.  
 +
* OsVIT2 was quickly induced in rice seedling roots and shoots after the treatment of 4.5 mM FeSO4, but OsVIT1 was not highly induced.  
 +
* Fe starvation caused downregulated ''OsVIT2'' expression in roots and shoots, and no OsVIT1 response until 7 days after treatment in roots.  
 +
* These data suggest that OsVIT1 may represent a housekeeping mechanism for Fe accumulation in vacuoles, while OsVIT2 functions more in response to external Fe levels <ref name="ref1" />.
  
 
===Subcellular localization===
 
===Subcellular localization===
 
+
* OsVIT1 and OsVIT2 were localized to vacuolar membrane<ref name="ref1" /> when they combined with enhanced green fluorescent protein and expressed(Figure 1).
[[File:OsVIT2.jpg|right|thumb|250px|'''Figure 1.'''Subcellular localization of OsVIT1 and OsVIT2<ref name="ref1" />.(a–c) Bright-field images of ''Arabidopsis'' protoplasts expressing enhanced green fluorescent protein (EGFP) (a), OsVIT1: EGFP (b) and OsVIT2: EGFP(c).(d–f) Fluorescence images of Arabidopsis protoplasts expressing EGFP (d), OsVIT1: EGFP (e) and OsVIT2: EGFP(f).(g–i) Merged fluorescence images of EGFP (g), OsVIT1: EGFP (h) and OsVIT2: EGFP (i). Bars = 10μm.]]
 
OsVIT1 and OsVIT2 were localized to vacuolar membrane<ref name="ref1" /> when they combined with enhanced green fluorescent protein and expressed(Figure 1).
 
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
* ''OsVIT2'' locates in chromosome 9, and encodes putative protein as the vacuolar iron transporter with 247 amino acids which shares 79.8% amino acid similarity with the VIT in ''Arabidopsis''.
 +
* There are five conserved transmembrane domains in OsVIT2 by further analyses.
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
Line 29: Line 41:
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os09g0396900|
 
Description = Protein of unknown function DUF125, transmembrane family protein|
 
Version = NM_001069636.1 GI:115479014 GeneID:4346978|
 
Length = 1732 bp|
 
Definition = Oryza sativa Japonica Group Os09g0396900, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 9|Chromosome 9]]|
 
AP = Chromosome 9:14485581..14487312|
 
CDS = 14485745..14485831,14486458..14486570,14486742..14487042|
 
GCID = <gbrowseImage1>
 
name=NC_008402:14485581..14487312
 
source=RiceChromosome09
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008402:14485581..14487312
 
source=RiceChromosome09
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggtgaaggagttcgtgcaggacgaggagaagcagcggctgctgctggacgagcacaccgagaagcacttcaccgccggcgaggtggccgcggagatcgcggacatactgtcgcagtatgggctgggcccagaggagtatgggcccgttgttaactccctccgcagcaaccccaaggcctggctcgaattcatgatgaagtttgagttgggactggagaagccggaaccaaggagggcgctgatgagcgcgggaacgatcgcgctggcttatgtggtgggtgggctggtgccactcctaccctacatgtttgtgccgacggccgaccgagccatggccacctcggtcgtcgtcacgctcgccgcacttctcttcttcggctatgtcaagggccggtttactggcaaccggcccttcatcagcgccttccagaccgctgttatcggcgctctcgcctccgccgccgccttcggcatggccaaggccgtgcagtccatctaa</cdnaseq>|
 
AA = <aaseq>MVKEFVQDEEKQRLLLDEHTEKHFTAGEVAAEIADILSQYGLGP                    EEYGPVVNSLRSNPKAWLEFMMKFELGLEKPEPRRALMSAGTIALAYVVGGLVPLLPY                    MFVPTADRAMATSVVVTLAALLFFGYVKGRFTGNRPFISAFQTAVIGALASAAAFGMA                    KAVQSI</aaseq>|
 
DNA = <dnaseqindica>165..251#878..990#1162..1462#gctcacacatcgatcacagaaagctaagctaaagtgctaaactaagcacgagaaaatctaatcaaccaagcttagattagatcattagctatatatagctaggcgatttaatcatccacgagctagcttattagctaagcagtagcagcagcagaagatcgaagatggtgaaggagttcgtgcaggacgaggagaagcagcggctgctgctggacgagcacaccgagaagcacttcaccgccggcgaggtggtccgcgacatcatcatcggcgtctccgacggcctcaccgtgccgttcgccctcgccgccggcctgtccggcgccaacgccccctccgccctcgtcctcaccgccggcctcgccgaggtcgccgccggcgccatctccatgggcctcggagggtaagcccaaaaccaaaaataaataaaaataaaacaaaataaaactttcctcctcttcttcttcctctgcaaatctctttctgttttttctttgatttctcaactattttgcttggcaaaatggcaagcatatgaatgcatgcgttttcacagccaaattaattaattaattacccttttttaccatgttttttcgctgcatttttctctcttggaattaaagttaattttgattgttattggattattttgattttaattataggtatctggcggcgaagagcgacgccgaccactaccaccgcgagctgcagagggagcaggaggagatcgacaccgtgccggacacaggtaattaattaagtcggtaacagtaattaatttctctcggagtttttttttactacatctgagtttattattaccacggtggtggttcgacggctgagattggtttggccccacttggcagaggccgcggagatcgcggacatactgtcgcagtatgggctgggcccagaggagtatgggcccgttgttaactccctccgcagcaaccccaaggcctggctcgaattcatgatgaagtaaggggaaaaaactaattaaatcgaattaaatttaaattaacttcattattatggaatttcatatttcttatgacaatagaaatgatttacatctcatgatcagtgtgggtgtcgtgtgttaaatacttggagaaatatataataacttatcggggacacatattataggtttgagttgggactggagaagccggaaccaaggagggcgctgatgagcgcgggaacgatcgcgctggcttatgtggtgggtgggctggtgccactcctaccctacatgtttgtgccgacggccgaccgagccatggccacctcggtcgtcgtcacgctcgccgcacttctcttcttcggctatgtcaagggccggtttactggcaaccggcccttcatcagcgccttccagaccgctgttatcggcgctctcgcctccgccgccgccttcggcatggccaaggccgtgcagtccatctaagtactgtagccggagctccggctgcaggcatccaagtaaatgtaattaatttagcagatccaataagtattgcagaaatgtatgtataagtatttatgtacgtttgctgcgtgcttgtagtgtattagatgttctggaggtgtatccgtagttagccctaagtgtaccatgtacacgagtgtaatcactcattttatatcgtcttctattttggctcccttttttatattcggttgggattaattaataatgtattgtcgatttgtaagc</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001069636.1 RefSeq:Os09g0396900]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 11:02, 7 May 2017

The rice Os09g0396900 was reported as OsVIT2 in 2012 by researchers from China.

Annotated Information

Gene Symbol

  • Os09g0396900 <=> OsVIT2,VIT2

Function

Figure 1.Subcellular localization of OsVIT1 and OsVIT2[1].
  • OsVIT1 and OsVIT2 may function primarily in flag leaves to mediate vacuolar sequestration of Fe and Zn, due to highly expression levels of OsVIT1 and OsVIT2 in flag leaves rather than embryos.
  • And they might also mediate allocation of Fe/Zn between flag leaves and the grains[1].

Phenotypic analysis

  • Knockdown of the vacuolar Fe transporter gene OsVIT1 or OsVIT2 may be useful to further increase the Fe concentration of seeds [2].

Expression

  • This gene expresses in flag leaf sheaths with a significantly high level, but it can also be detected in various tissues/organs including embryos at low levels.
  • Different from OsVIT2, OsVIT1 expresses mainly in flag leaf blades, but also occurs ubiquitously in various tissues/organs including embryos with relatively low levels[1].
  • OsVIT2 was quickly induced in rice seedling roots and shoots after the treatment of 4.5 mM FeSO4, but OsVIT1 was not highly induced.
  • Fe starvation caused downregulated OsVIT2 expression in roots and shoots, and no OsVIT1 response until 7 days after treatment in roots.
  • These data suggest that OsVIT1 may represent a housekeeping mechanism for Fe accumulation in vacuoles, while OsVIT2 functions more in response to external Fe levels [1].

Subcellular localization

  • OsVIT1 and OsVIT2 were localized to vacuolar membrane[1] when they combined with enhanced green fluorescent protein and expressed(Figure 1).

Evolution

  • OsVIT2 locates in chromosome 9, and encodes putative protein as the vacuolar iron transporter with 247 amino acids which shares 79.8% amino acid similarity with the VIT in Arabidopsis.
  • There are five conserved transmembrane domains in OsVIT2 by further analyses.

You can also add sub-section(s) at will.

Labs working on this gene

  • National Key Laboratory of Plant Molecular Genetics and National Center for Plant Gene Research (Shanghai), Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, China
  • Zhejiang Province Key Laboratory of Technology for Improving Agricultural Product Quality, School of Agricultural and Food Science, Zhejiang Agriculture and Forest University, China

References

  1. 1.0 1.1 1.2 1.3 1.4 Yu Zhang, Yong-Han Xu, Hong-Yin Yi, and Ji-Ming Gong. Vacuolar membrane transporters OsVIT1 and OsVIT2 modulate iron translocation between flag leaves and seeds in rice. The Plant Journal (2012)72, 400–410.
  2. Hiroshi Masuda, May Sann Aung, and Naoko K Nishizawa. Iron biofortification of rice using different transgenic approaches. Rice 2013,6:40.

Structured Information