Difference between revisions of "Os03g0786400"

From RiceWiki
Jump to: navigation, search
(Labs working on this gene)
 
(9 intermediate revisions by 3 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os03g0786400''''' was reported as '''''DST''''' in 2013 by researchers from China <ref name="ref1" /> .  
  
 
==Annotated Information==
 
==Annotated Information==
 +
[[File:16-Os03g0786400.png|right|thumb|527px|'''Figure S1.''' ''Phenotypic characterization of NIL DST REG1/reg1 plants<ref name="ref1" />.'']]
 +
 +
===Gene Symbol===
 +
*'''''Os03g0786400''''' '''''<=>''''' '''''DST, OsDST'''''
 +
 
===Function===
 
===Function===
Please input function information here.
+
* The zinc finger transcription factor DROUGHT AND SALT TOLERANCE ('''''DST''''') directly regulates OsCKX2 expression in the reproductive meristem.
 +
* '''''DST'''''-directed expression of '''''OsCKX2''''' regulates CK accumulation in the SAM and, therefore, controls the number of the reproductive organs.
 +
* A semidominant allele of the '''''DST''''' gene, perturbs '''''DST'''''-directed regulation of '''''OsCKX2''''' expression and elevates CK levels in the reproductive SAM, leading to increased meristem activity, enhanced panicle branching, and a consequent increase of grain number.
 +
* '''''DST''''' is a unique regulator of reproductive meristem activity.
 +
* '''''DST''''' may be explored to facilitate the genetic enhancement of grain production in rice and other small grain cereals<ref name="ref1" /> <ref name="ref2" /> <ref name="ref3" /> <ref name="ref4" /> <ref name="ref5" /> .
 +
 
 +
===Phenotypic analysis===
 +
* '''''DST''''' reg1 Enhances Grain Production in both indica and jopanic Rice.
 +
* All transgenic plants overexpressing a wild-type DST allele (DSTREG1) showed reduced plant stature with less panicle branches and decreased grain number.
 +
* In contrast, the DST RNA interference (RNAi) transgenic plants showed increased panicle branches and enhanced grain number.
 +
* Similarly, transgenic plants overexpressing the reg1 mutant allele of DST (DST reg1 ) had increased panicle branches and produced more grains.
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
* DST is located in the nucleus with transcriptional activation and it will express momentarily down under the condition of salt stress and osmotic stress, then recovered to pre-treatment levels.  
 
 
===Evolution===
 
Please input evolution information here.
 
 
 
You can also add sub-section(s) at will.
 
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* State Key Laboratory of Plant Genomics, National Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, China;
 +
* State Key Laboratory of Hybrid Rice, China National Hybrid Rice Research and Development Center, Changsha 410125, China;
 +
* State Key Laboratory of Rice Biology, China National Rice Research Institute, Chinese Academy of Agricultural Sciences, Hangzhou 310006, China; * Key Laboratory of Analytical Chemistry for Biology and Medicine (Ministry of Education), Department of Chemistry, Wuhan University, Wuhan 430072, China
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
<ref name="ref1">Shuyu Li;Bingran Zhao;Dingyang Yuan; Rice zinc finger protein DST enhances grain production through controlling Gn1a/OsCKX2 expression; Proceedings of the National Academy of Sciences, 2013, 110(8): 3167-3172</ref>
 +
<ref name="ref2"> Xin-Yuan Huang;Dai-Yin Chao; A previously unknown zinc finger protein, DST, regulates drought and salt tolerance in rice via stomatal aperture control; GENES & DEVELOPMENT, 2009, 23(15): 1805-1817</ref>
 +
<ref name="ref3"> Wolfe SA, Nekludova L, Pabo CO(2000) DNA recognition by Cys(2)His(2) zinc finger proteins. Annu Rev Biophys Biomol Struct 29:183–212.</ref>
 +
<ref name="ref4"> Sakamoto H, Maruyama K, Sakuma Y, Meshi T, Iwabuchi M, Shinozaki K, Yamaguchi-Shinozaki K(2004) Arabidopsis Cys2/His2-type zinc-finger proteins function as transcription repressors under drought, cold, and high-salinity stress conditions. Plant Physiol 136:2734–2746.</ref>
 +
<ref name="ref5">  Lin R, Ding L, Casola C, Ripoll DR, Feschotte C, Wang H(2007) Transposase-derived transcription factors regulate light signaling in Arabidopsis. Science 318:1302–1305.</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os03g0786400|
 
Description = Zinc finger, C2H2-type domain containing protein|
 
Version = NM_001058023.1 GI:115455774 GeneID:4334350|
 
Length = 1205 bp|
 
Definition = Oryza sativa Japonica Group Os03g0786400, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|
 
AP = Chromosome 3:33496391..33497595|
 
CDS = 33496699..33497586|
 
GCID = <gbrowseImage1>
 
name=NC_008396:33496391..33497595
 
source=RiceChromosome03
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008396:33496391..33497595
 
source=RiceChromosome03
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggcggcgcaggcggccgacctgtcgctgacgctggcgccgtcgggagggggtggtgggggaggaggaggcggcggcggtggtgggtcgtcgtcggcgtgcatcgacggcaaggacgtgcggctgttcccgtgcttgttctgcaacaagaagttcttgaagtcgcaggcgctgggcgggcaccagaacgcgcacaagaaggagcggagcatcgggtggaatccctacttctacatgccgccgacgccgcaccccgccggcaatgccgccgccgccgccgcggcggcgacgcccggtgggatgtcgtccgtcacgacgccatccgggagctacggcgtcgtcggtggtgccgccgtcggggctactgctggcgttgggggcggaggtggagtgggaggggggcttctcccggcgcacgcgtacgccgggcacgggtacgccgcggtgccgacgtcgttccccatcgcgtcgcacagctcgagcgtggttggctccggtgggctgcagtactacgctggtaccgactgcggcgcggcggcggcgggtgcggcgaagacgacgacgacggcggcggcggcggcgacggccgtggcggggagcgagagcggcgtgcaggtgccccggttcgcgacgcaccagcaccatctcctggcggtggtgagcagcgggcgcgcgatgctggcggcgcccgaccagccgggcgccgggcgcgacgacatgatcgacatgctcaactggaggcgaggctcccacggccccaccgcctccgccgccgccaccacgccctccccggcaagcaccaccaccacgctcaccaccttcgccagcgccgacggcagcaacaacggcgaggagaacgaggagctcgacctcaacttgagcctctag</cdnaseq>|
 
AA = <aaseq>MAAQAADLSLTLAPSGGGGGGGGGGGGGGSSSACIDGKDVRLFP                    CLFCNKKFLKSQALGGHQNAHKKERSIGWNPYFYMPPTPHPAGNAAAAAAAATPGGMS                    SVTTPSGSYGVVGGAAVGATAGVGGGGGVGGGLLPAHAYAGHGYAAVPTSFPIASHSS                    SVVGSGGLQYYAGTDCGAAAAGAAKTTTTAAAAATAVAGSESGVQVPRFATHQHHLLA                    VVSSGRAMLAAPDQPGAGRDDMIDMLNWRRGSHGPTASAAATTPSPASTTTTLTTFAS                    ADGSNNGEENEELDLNLSL</aaseq>|
 
DNA = <dnaseqindica>10..897#ccgtcgcctatggcggcgcaggcggccgacctgtcgctgacgctggcgccgtcgggagggggtggtgggggaggaggaggcggcggcggtggtgggtcgtcgtcggcgtgcatcgacggcaaggacgtgcggctgttcccgtgcttgttctgcaacaagaagttcttgaagtcgcaggcgctgggcgggcaccagaacgcgcacaagaaggagcggagcatcgggtggaatccctacttctacatgccgccgacgccgcaccccgccggcaatgccgccgccgccgccgcggcggcgacgcccggtgggatgtcgtccgtcacgacgccatccgggagctacggcgtcgtcggtggtgccgccgtcggggctactgctggcgttgggggcggaggtggagtgggaggggggcttctcccggcgcacgcgtacgccgggcacgggtacgccgcggtgccgacgtcgttccccatcgcgtcgcacagctcgagcgtggttggctccggtgggctgcagtactacgctggtaccgactgcggcgcggcggcggcgggtgcggcgaagacgacgacgacggcggcggcggcggcgacggccgtggcggggagcgagagcggcgtgcaggtgccccggttcgcgacgcaccagcaccatctcctggcggtggtgagcagcgggcgcgcgatgctggcggcgcccgaccagccgggcgccgggcgcgacgacatgatcgacatgctcaactggaggcgaggctcccacggccccaccgcctccgccgccgccaccacgccctccccggcaagcaccaccaccacgctcaccaccttcgccagcgccgacggcagcaacaacggcgaggagaacgaggagctcgacctcaacttgagcctctagctcccaccaccaccacctcctcctccgccgccgccgccgccgccgcgcaatccaagaaggcaaggtcaatcaatcgccatgttcttcttctccaagctccacctactcctcttccaattcctcctcgtgtgtgattaatccccctcttcttgctgcctgcgtacgtactccttaattaattagctcttagggacgttaattaatctcagttcttggctctcttctcctctcctctcctctcctctcatctcacttgtatgttaatgttagtactccttgtaatcgatcaatcagtcctctttttttgc</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001058023.1 RefSeq:Os03g0786400]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 16:14, 7 May 2017

The rice Os03g0786400 was reported as DST in 2013 by researchers from China [1] .

Annotated Information

Figure S1. Phenotypic characterization of NIL DST REG1/reg1 plants[1].

Gene Symbol

  • Os03g0786400 <=> DST, OsDST

Function

  • The zinc finger transcription factor DROUGHT AND SALT TOLERANCE (DST) directly regulates OsCKX2 expression in the reproductive meristem.
  • DST-directed expression of OsCKX2 regulates CK accumulation in the SAM and, therefore, controls the number of the reproductive organs.
  • A semidominant allele of the DST gene, perturbs DST-directed regulation of OsCKX2 expression and elevates CK levels in the reproductive SAM, leading to increased meristem activity, enhanced panicle branching, and a consequent increase of grain number.
  • DST is a unique regulator of reproductive meristem activity.
  • DST may be explored to facilitate the genetic enhancement of grain production in rice and other small grain cereals[1] [2] [3] [4] [5] .

Phenotypic analysis

  • DST reg1 Enhances Grain Production in both indica and jopanic Rice.
  • All transgenic plants overexpressing a wild-type DST allele (DSTREG1) showed reduced plant stature with less panicle branches and decreased grain number.
  • In contrast, the DST RNA interference (RNAi) transgenic plants showed increased panicle branches and enhanced grain number.
  • Similarly, transgenic plants overexpressing the reg1 mutant allele of DST (DST reg1 ) had increased panicle branches and produced more grains.

Expression

  • DST is located in the nucleus with transcriptional activation and it will express momentarily down under the condition of salt stress and osmotic stress, then recovered to pre-treatment levels.

Labs working on this gene

  • State Key Laboratory of Plant Genomics, National Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, China;
  • State Key Laboratory of Hybrid Rice, China National Hybrid Rice Research and Development Center, Changsha 410125, China;
  • State Key Laboratory of Rice Biology, China National Rice Research Institute, Chinese Academy of Agricultural Sciences, Hangzhou 310006, China; * Key Laboratory of Analytical Chemistry for Biology and Medicine (Ministry of Education), Department of Chemistry, Wuhan University, Wuhan 430072, China

References

  1. 1.0 1.1 1.2 Shuyu Li;Bingran Zhao;Dingyang Yuan; Rice zinc finger protein DST enhances grain production through controlling Gn1a/OsCKX2 expression; Proceedings of the National Academy of Sciences, 2013, 110(8): 3167-3172
  2. Xin-Yuan Huang;Dai-Yin Chao; A previously unknown zinc finger protein, DST, regulates drought and salt tolerance in rice via stomatal aperture control; GENES & DEVELOPMENT, 2009, 23(15): 1805-1817
  3. Wolfe SA, Nekludova L, Pabo CO(2000) DNA recognition by Cys(2)His(2) zinc finger proteins. Annu Rev Biophys Biomol Struct 29:183–212.
  4. Sakamoto H, Maruyama K, Sakuma Y, Meshi T, Iwabuchi M, Shinozaki K, Yamaguchi-Shinozaki K(2004) Arabidopsis Cys2/His2-type zinc-finger proteins function as transcription repressors under drought, cold, and high-salinity stress conditions. Plant Physiol 136:2734–2746.
  5. Lin R, Ding L, Casola C, Ripoll DR, Feschotte C, Wang H(2007) Transposase-derived transcription factors regulate light signaling in Arabidopsis. Science 318:1302–1305.

Structured Information