Difference between revisions of "Os03g0786400"

From RiceWiki
Jump to: navigation, search
(→‎Evolution)
(→‎Labs working on this gene)
 
(7 intermediate revisions by 3 users not shown)
Line 1: Line 1:
−
Please input one-sentence summary here.
+
The rice '''''Os03g0786400''''' was reported as '''''DST''''' in 2013 by researchers from China <ref name="ref1" /> .  
  
 
==Annotated Information==
 
==Annotated Information==
 +
[[File:16-Os03g0786400.png|right|thumb|527px|'''Figure S1.''' ''Phenotypic characterization of NIL DST REG1/reg1 plants<ref name="ref1" />.'']]
 +
 +
===Gene Symbol===
 +
*'''''Os03g0786400''''' '''''<=>''''' '''''DST, OsDST'''''
 +
 
===Function===
 
===Function===
−
The Cys-2/His-2-type (C2H2) zinc finger protein—also called a classical or TFIIIA-type zinc finger—that was first found in Xenopus oocytes is an important class of eukaryotic transcription factors[1].
+
* The zinc finger transcription factor DROUGHT AND SALT TOLERANCE ('''''DST''''') directly regulates OsCKX2 expression in the reproductive meristem.
−
The phytohormone cytokinin (CK) positively regulates the activity and function of the shoot apical meristem (SAM), which is a major parameter determining seed production. The rice (Oryza sativa L.) Gn1a/OsCKX2 (Grain number 1a/Cytokinin oxidase 2) gene, which encodes a cytokinin oxidase, has been identified as a major quantitative trait locus contributing to grain number improvement in rice breeding practice. The zinc finger transcription factor DROUGHT AND SALT TOLERANCE (DST) directly regulates OsCKX2 expression in the reproductive meristem. DST-directed expression of OsCKX2 regulates CK accumulation in the SAM and, therefore, controls the number of the reproductive organs[2].  
+
* '''''DST'''''-directed expression of '''''OsCKX2''''' regulates CK accumulation in the SAM and, therefore, controls the number of the reproductive organs.
−
And the zinc finger transcription factor  can negatively regulate stomatal closure by direct modulation of genes related to H2O2 homeostasis. Loss of DST function increases stomatal closure and reduces stomatal density, consequently resulting in enhanced drought and salt tolerance in rice[3].
+
* A semidominant allele of the '''''DST''''' gene, perturbs '''''DST'''''-directed regulation of '''''OsCKX2''''' expression and elevates CK levels in the reproductive SAM, leading to increased meristem activity, enhanced panicle branching, and a consequent increase of grain number.
 +
* '''''DST''''' is a unique regulator of reproductive meristem activity.
 +
* '''''DST''''' may be explored to facilitate the genetic enhancement of grain production in rice and other small grain cereals<ref name="ref1" /> <ref name="ref2" /> <ref name="ref3" /> <ref name="ref4" /> <ref name="ref5" /> .
 +
 
 +
===Phenotypic analysis===
 +
* '''''DST''''' reg1 Enhances Grain Production in both indica and jopanic Rice.
 +
* All transgenic plants overexpressing a wild-type DST allele (DSTREG1) showed reduced plant stature with less panicle branches and decreased grain number.
 +
* In contrast, the DST RNA interference (RNAi) transgenic plants showed increased panicle branches and enhanced grain number.
 +
* Similarly, transgenic plants overexpressing the reg1 mutant allele of DST (DST reg1 ) had increased panicle branches and produced more grains.
  
 
===Expression===
 
===Expression===
−
Please input expression information here.
+
* DST is located in the nucleus with transcriptional activation and it will express momentarily down under the condition of salt stress and osmotic stress, then recovered to pre-treatment levels.  
−
 
 
−
===Evolution===
 
−
Generally, C2H2-type zinc finger proteins contain more than one zinc finger motif for DNA binding in the N terminus and separable transcriptional activation (or repression) domains in the C terminus [4]. The zinc finger motif is thought to recognize and bind its target DNA sequence, but has never been shown to be required for transcriptional activity [4,5,6].
 
  
 
==Labs working on this gene==
 
==Labs working on this gene==
−
Please input related labs here.
+
* State Key Laboratory of Plant Genomics, National Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, China;
 +
* State Key Laboratory of Hybrid Rice, China National Hybrid Rice Research and Development Center, Changsha 410125, China;
 +
* State Key Laboratory of Rice Biology, China National Rice Research Institute, Chinese Academy of Agricultural Sciences, Hangzhou 310006, China; * Key Laboratory of Analytical Chemistry for Biology and Medicine (Ministry of Education), Department of Chemistry, Wuhan University, Wuhan 430072, China
  
 
==References==
 
==References==
−
Please input cited references here.
+
<references>
 +
<ref name="ref1">Shuyu Li;Bingran Zhao;Dingyang Yuan; Rice zinc finger protein DST enhances grain production through controlling Gn1a/OsCKX2 expression; Proceedings of the National Academy of Sciences, 2013, 110(8): 3167-3172</ref>
 +
<ref name="ref2"> Xin-Yuan Huang;Dai-Yin Chao; A previously unknown zinc finger protein, DST, regulates drought and salt tolerance in rice via stomatal aperture control; GENES & DEVELOPMENT, 2009, 23(15): 1805-1817</ref>
 +
<ref name="ref3"> Wolfe SA, Nekludova L, Pabo CO(2000) DNA recognition by Cys(2)His(2) zinc finger proteins. Annu Rev Biophys Biomol Struct 29:183–212.</ref>
 +
<ref name="ref4"> Sakamoto H, Maruyama K, Sakuma Y, Meshi T, Iwabuchi M, Shinozaki K, Yamaguchi-Shinozaki K(2004) Arabidopsis Cys2/His2-type zinc-finger proteins function as transcription repressors under drought, cold, and high-salinity stress conditions. Plant Physiol 136:2734–2746.</ref>
 +
<ref name="ref5">  Lin R, Ding L, Casola C, Ripoll DR, Feschotte C, Wang H(2007) Transposase-derived transcription factors regulate light signaling in Arabidopsis. Science 318:1302–1305.</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
−
{{JaponicaGene|
 
−
GeneName = Os03g0786400|
 
−
Description = Zinc finger, C2H2-type domain containing protein|
 
−
Version = NM_001058023.1 GI:115455774 GeneID:4334350|
 
−
Length = 1205 bp|
 
−
Definition = Oryza sativa Japonica Group Os03g0786400, complete gene.|
 
−
Source = Oryza sativa Japonica Group
 
  
−
  ORGANISM  Oryza sativa Japonica Group
 
−
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
−
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
−
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
−
|
 
−
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|
 
−
AP = Chromosome 3:33496391..33497595|
 
−
CDS = 33496699..33497586|
 
−
GCID = <gbrowseImage1>
 
−
name=NC_008396:33496391..33497595
 
−
source=RiceChromosome03
 
−
preset=GeneLocation
 
−
</gbrowseImage1>|
 
−
GSID = <gbrowseImage2>
 
−
name=NC_008396:33496391..33497595
 
−
source=RiceChromosome03
 
−
preset=GeneLocation
 
−
</gbrowseImage2>|
 
−
CDNA = <cdnaseq>atggcggcgcaggcggccgacctgtcgctgacgctggcgccgtcgggagggggtggtgggggaggaggaggcggcggcggtggtgggtcgtcgtcggcgtgcatcgacggcaaggacgtgcggctgttcccgtgcttgttctgcaacaagaagttcttgaagtcgcaggcgctgggcgggcaccagaacgcgcacaagaaggagcggagcatcgggtggaatccctacttctacatgccgccgacgccgcaccccgccggcaatgccgccgccgccgccgcggcggcgacgcccggtgggatgtcgtccgtcacgacgccatccgggagctacggcgtcgtcggtggtgccgccgtcggggctactgctggcgttgggggcggaggtggagtgggaggggggcttctcccggcgcacgcgtacgccgggcacgggtacgccgcggtgccgacgtcgttccccatcgcgtcgcacagctcgagcgtggttggctccggtgggctgcagtactacgctggtaccgactgcggcgcggcggcggcgggtgcggcgaagacgacgacgacggcggcggcggcggcgacggccgtggcggggagcgagagcggcgtgcaggtgccccggttcgcgacgcaccagcaccatctcctggcggtggtgagcagcgggcgcgcgatgctggcggcgcccgaccagccgggcgccgggcgcgacgacatgatcgacatgctcaactggaggcgaggctcccacggccccaccgcctccgccgccgccaccacgccctccccggcaagcaccaccaccacgctcaccaccttcgccagcgccgacggcagcaacaacggcgaggagaacgaggagctcgacctcaacttgagcctctag</cdnaseq>|
 
−
AA = <aaseq>MAAQAADLSLTLAPSGGGGGGGGGGGGGGSSSACIDGKDVRLFP                    CLFCNKKFLKSQALGGHQNAHKKERSIGWNPYFYMPPTPHPAGNAAAAAAAATPGGMS                    SVTTPSGSYGVVGGAAVGATAGVGGGGGVGGGLLPAHAYAGHGYAAVPTSFPIASHSS                    SVVGSGGLQYYAGTDCGAAAAGAAKTTTTAAAAATAVAGSESGVQVPRFATHQHHLLA                    VVSSGRAMLAAPDQPGAGRDDMIDMLNWRRGSHGPTASAAATTPSPASTTTTLTTFAS                    ADGSNNGEENEELDLNLSL</aaseq>|
 
−
DNA = <dnaseqindica>10..897#ccgtcgcctatggcggcgcaggcggccgacctgtcgctgacgctggcgccgtcgggagggggtggtgggggaggaggaggcggcggcggtggtgggtcgtcgtcggcgtgcatcgacggcaaggacgtgcggctgttcccgtgcttgttctgcaacaagaagttcttgaagtcgcaggcgctgggcgggcaccagaacgcgcacaagaaggagcggagcatcgggtggaatccctacttctacatgccgccgacgccgcaccccgccggcaatgccgccgccgccgccgcggcggcgacgcccggtgggatgtcgtccgtcacgacgccatccgggagctacggcgtcgtcggtggtgccgccgtcggggctactgctggcgttgggggcggaggtggagtgggaggggggcttctcccggcgcacgcgtacgccgggcacgggtacgccgcggtgccgacgtcgttccccatcgcgtcgcacagctcgagcgtggttggctccggtgggctgcagtactacgctggtaccgactgcggcgcggcggcggcgggtgcggcgaagacgacgacgacggcggcggcggcggcgacggccgtggcggggagcgagagcggcgtgcaggtgccccggttcgcgacgcaccagcaccatctcctggcggtggtgagcagcgggcgcgcgatgctggcggcgcccgaccagccgggcgccgggcgcgacgacatgatcgacatgctcaactggaggcgaggctcccacggccccaccgcctccgccgccgccaccacgccctccccggcaagcaccaccaccacgctcaccaccttcgccagcgccgacggcagcaacaacggcgaggagaacgaggagctcgacctcaacttgagcctctagctcccaccaccaccacctcctcctccgccgccgccgccgccgccgcgcaatccaagaaggcaaggtcaatcaatcgccatgttcttcttctccaagctccacctactcctcttccaattcctcctcgtgtgtgattaatccccctcttcttgctgcctgcgtacgtactccttaattaattagctcttagggacgttaattaatctcagttcttggctctcttctcctctcctctcctctcctctcatctcacttgtatgttaatgttagtactccttgtaatcgatcaatcagtcctctttttttgc</dnaseqindica>|
 
−
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001058023.1 RefSeq:Os03g0786400]|
 
−
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 16:14, 7 May 2017

The rice Os03g0786400 was reported as DST in 2013 by researchers from China [1] .

Annotated Information

Figure S1. Phenotypic characterization of NIL DST REG1/reg1 plants[1].

Gene Symbol

  • Os03g0786400 <=> DST, OsDST

Function

  • The zinc finger transcription factor DROUGHT AND SALT TOLERANCE (DST) directly regulates OsCKX2 expression in the reproductive meristem.
  • DST-directed expression of OsCKX2 regulates CK accumulation in the SAM and, therefore, controls the number of the reproductive organs.
  • A semidominant allele of the DST gene, perturbs DST-directed regulation of OsCKX2 expression and elevates CK levels in the reproductive SAM, leading to increased meristem activity, enhanced panicle branching, and a consequent increase of grain number.
  • DST is a unique regulator of reproductive meristem activity.
  • DST may be explored to facilitate the genetic enhancement of grain production in rice and other small grain cereals[1] [2] [3] [4] [5] .

Phenotypic analysis

  • DST reg1 Enhances Grain Production in both indica and jopanic Rice.
  • All transgenic plants overexpressing a wild-type DST allele (DSTREG1) showed reduced plant stature with less panicle branches and decreased grain number.
  • In contrast, the DST RNA interference (RNAi) transgenic plants showed increased panicle branches and enhanced grain number.
  • Similarly, transgenic plants overexpressing the reg1 mutant allele of DST (DST reg1 ) had increased panicle branches and produced more grains.

Expression

  • DST is located in the nucleus with transcriptional activation and it will express momentarily down under the condition of salt stress and osmotic stress, then recovered to pre-treatment levels.

Labs working on this gene

  • State Key Laboratory of Plant Genomics, National Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, China;
  • State Key Laboratory of Hybrid Rice, China National Hybrid Rice Research and Development Center, Changsha 410125, China;
  • State Key Laboratory of Rice Biology, China National Rice Research Institute, Chinese Academy of Agricultural Sciences, Hangzhou 310006, China; * Key Laboratory of Analytical Chemistry for Biology and Medicine (Ministry of Education), Department of Chemistry, Wuhan University, Wuhan 430072, China

References

  1. ↑ 1.0 1.1 1.2 Shuyu Li;Bingran Zhao;Dingyang Yuan; Rice zinc finger protein DST enhances grain production through controlling Gn1a/OsCKX2 expression; Proceedings of the National Academy of Sciences, 2013, 110(8): 3167-3172
  2. ↑ Xin-Yuan Huang;Dai-Yin Chao; A previously unknown zinc finger protein, DST, regulates drought and salt tolerance in rice via stomatal aperture control; GENES & DEVELOPMENT, 2009, 23(15): 1805-1817
  3. ↑ Wolfe SA, Nekludova L, Pabo CO(2000) DNA recognition by Cys(2)His(2) zinc finger proteins. Annu Rev Biophys Biomol Struct 29:183–212.
  4. ↑ Sakamoto H, Maruyama K, Sakuma Y, Meshi T, Iwabuchi M, Shinozaki K, Yamaguchi-Shinozaki K(2004) Arabidopsis Cys2/His2-type zinc-finger proteins function as transcription repressors under drought, cold, and high-salinity stress conditions. Plant Physiol 136:2734–2746.
  5. ↑ Lin R, Ding L, Casola C, Ripoll DR, Feschotte C, Wang H(2007) Transposase-derived transcription factors regulate light signaling in Arabidopsis. Science 318:1302–1305.

Structured Information

Retrieved from "https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0786400&oldid=277927"