Difference between revisions of "Os01g0177400"

From RiceWiki
Jump to: navigation, search
(Function)
(Annotated Information)
 
(9 intermediate revisions by 4 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os01g0177400''''' was reported as '''''OsGA3ox2''''' in 2003 <ref name="ref1" /> by researchers from Japan.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
[[File:Os01g0177400.png|right|thumb|227px|'''Figure 4.''' ''Phenotype of D18:OsGA2ox1 transgenic rice.<ref name="ref1" />.'']]
 +
===Gene Symbol===
 +
*'''''Os01g0177400''''' '''''<=>''''' '''''GA3OX2, GA3ox1,  OsGA3ox2, d18,OsD18'''''
 +
 
===Function===
 
===Function===
Please input function information here.
+
* OsGA3ox2 (D18) encodes GA 3-oxidase.
D18 CDS 1113 bp, contains three exons, encoding a 370 amino acid composition of protein products.
+
* OsGA3ox2 is important in controlling bioactive GA synthesis for shoot elongation but not for reproductive development.
Phytochrome in the regulation of rice section elongation of different levels, such as regulating OsGA3ox2 GA biosynthesis gene expression, the expression of ACO1 section and the elongation of the initial (Iwamoto et al. 2011)
 
Gibberellin 3 beta hydroxylase activity (0016707) GO:
 
  
 +
===Phenotypic analysis===
 +
The rice d18 mutant is a severe GA-deficient dwarf, but its flower and grain development are not affected。
 
===Expression===
 
===Expression===
Please input expression information here.
+
* In wild-type rice, expression of OsGA3ox2 is regulated by the endogenous bioactive GA content.
 +
* Indeed, the OsGA3ox2 transcript was upregulated by uniconazole (an inhibitor of GA biosynthesis) treatment and downregulated by bioactive GA 3 application —as was the transcript of the green revolution rice gene, OsGA20ox2 (SD1), which encodes GA 20-oxidase 9.
  
===Evolution===
+
You can also add sub-section(s) at will.
Please input evolution information here.
 
  
You can also add sub-section(s) at will.
+
===Knowledge Extension===
 +
* Dwarfing is one of the most valuable traits in crop breeding, because it results in plants that are more resistant to damage by wind and rain (lodging resistant) and have stable increased yields.
 +
* Dwarf mutants have been extensively characterized in many plant species. The endogenous phytohormone GA is one of several factors associated with the dwarf phenotype.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* Field Production Science Center, The University of Tokyo, 1-1-1 Midoricyo, Nishi-Tokyo 188-0002, Japan.
 +
* National Institute of Agrobiological Sciences, 2-1-2 Kannondai, Tsukuba, Ibaraki 305-8602, Japan.
 +
* BioResource Center, RIKEN Tsukuba Institute, 3-1-1 Koyadai, Tsukuba, Ibaraki 305-0074, Japan.
 +
* Bioscience and Biotechnology Center, Nagoya University, Furocyo, Chikusa, Nagoya, Aichi 464-8601, Japan.
 +
* Institute of Agriculture and Forestry, University of Tsukuba, 1-1-1 Tennoudai, Tsukuba, Ibaraki 305-8572, Japan.
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Sakamoto T, Morinaka Y, Ishiyama K, Kobayashi M, Itoh H, Kayano T, Iwahori S,
 +
Matsuoka M, Tanaka H. Genetic manipulation of gibberellin metabolism in
 +
transgenic rice. Nat Biotechnol. 2003 Aug;21(8):909-13. Epub 2003 Jul 13. PubMed
 +
PMID: 12858182.
 +
</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os01g0177400|
 
Description = GA 3beta-hydroxylase|
 
Version = NM_001048721.1 GI:115434855 GeneID:4323864|
 
Length = 1229 bp|
 
Definition = Oryza sativa Japonica Group Os01g0177400, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
 
AP = Chromosome 1:4002659..4003887|
 
CDS = 4002659..4003307,4003415..4003697,4003707..4003887|
 
GCID = <gbrowseImage1>
 
name=NC_008394:4002659..4003887
 
source=RiceChromosome01
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008394:4002659..4003887
 
source=RiceChromosome01
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atgccgacgccgtcgcacttgaagaacccgctctgcttcgacttccgggcggcgaggcgggtgccggagacgcacgcgtggccggggctggacgaccacccggtggtggacggcggcggcggcggcggcgaggacgcggtgccggtggtggacgtcggggcgggcgacgcggcggcgcgggcggcggagcagtggggcgcgttccttctggtcgggcacggcgtgccggcggcgctgctgtcgcgcgtcgaggagcgcgtcgcccgcgtgttctccctgccggcgtcggagaagatgcgcgccgtccgcggccccggcgagccctgcggctacggctcgccgcccatctcctccttcttctccaagctcatgtggtccgagggctacaccttctccccttcctccctccgctccgagctccgccgcctctggcccaagtccggcgacgactacctcctcttctgtgacgtgatggaggagtttcacaaggagatgcggcggctagccgacgagttgctgaggttgttcttgagggcgctggggctcaccggcgaggaggtcgccggagtcgaggcggagaggaggatcggcgagaggatgacggcgacggtgcacctcaactggtacccgaggtgcccggagccgcggcgagcgctggggctcatcgcgcacacggactcgggcttcttcaccttcgtgctccagagcctcgtcccggggctgcagctgttccgtcgagggcccgaccggtgggtggcggtgccggcggtggcgggggccttcgtcgtcaacgtcggcgacctcttccacatcctcaccaacggccgcttccacagcgtctaccaccgcgccgtcgtgaaccgcgaccgcgaccgggtctcgctcggctacttcctcggcccgccgccggacgccgaggtggcgccgctgccggaggccgtgccggccggccggagccccgcctaccgcgctgtcacgtggccggagtacatggccgtccgcaagaaggccttcgccaccggcggctccgccctcaagatggtctccaccgacgccgccgccgccgccgacgaacacgacgacgtcgccgccgccgccgacgtccacgcataa</cdnaseq>|
 
AA = <aaseq>MPTPSHLKNPLCFDFRAARRVPETHAWPGLDDHPVVDGGGGGGE                    DAVPVVDVGAGDAAARAAEQWGAFLLVGHGVPAALLSRVEERVARVFSLPASEKMRAV                    RGPGEPCGYGSPPISSFFSKLMWSEGYTFSPSSLRSELRRLWPKSGDDYLLFCDVMEE                    FHKEMRRLADELLRLFLRALGLTGEEVAGVEAERRIGERMTATVHLNWYPRCPEPRRA                    LGLIAHTDSGFFTFVLQSLVPGLQLFRRGPDRWVAVPAVAGAFVVNVGDLFHILTNGR                    FHSVYHRAVVNRDRDRVSLGYFLGPPPDAEVAPLPEAVPAGRSPAYRAVTWPEYMAVR                    KKAFATGGSALKMVSTDAAAAADEHDDVAAAADVHA</aaseq>|
 
DNA = <dnaseqindica>581..1229#191..473#1..181#atgccgacgccgtcgcacttgaagaacccgctctgcttcgacttccgggcggcgaggcgggtgccggagacgcacgcgtggccggggctggacgaccacccggtggtggacggcggcggcggcggcggcgaggacgcggtgccggtggtggacgtcggggcgggcgacgcggcggcgcgggtggcgcgggcggcggagcagtggggcgcgttccttctggtcgggcacggcgtgccggcggcgctgctgtcgcgcgtcgaggagcgcgtcgcccgcgtgttctccctgccggcgtcggagaagatgcgcgccgtccgcggccccggcgagccctgcggctacggctcgccgcccatctcctccttcttctccaagctcatgtggtccgagggctacaccttctccccttcctccctccgctccgagctccgccgcctctggcccaagtccggcgacgactacctcctcttctggtatatatacatatatactctcccatgcattccatgcacatacactctacgtatatatctacctctacgtatatatctacgtattgatctacgtataatatacgcagtgacgtgatggaggagtttcacaaggagatgcggcggctagccgacgagttgctgaggttgttcttgagggcgctggggctcaccggcgaggaggtcgccggagtcgaggcggagaggaggatcggcgagaggatgacggcgacggtgcacctcaactggtacccgaggtgcccggagccgcggcgagcgctggggctcatcgcgcacacggactcgggcttcttcaccttcgtgctccagagcctcgtcccggggctgcagctgttccgtcgagggcccgaccggtgggtggcggtgccggcggtggcgggggccttcgtcgtcaacgtcggcgacctcttccacatcctcaccaacggccgcttccacagcgtctaccaccgcgccgtcgtgaaccgcgaccgcgaccgggtctcgctcggctacttcctcggcccgccgccggacgccgaggtggcgccgctgccggaggccgtgccggccggccggagccccgcctaccgcgctgtcacgtggccggagtacatggccgtccgcaagaaggccttcgccaccggcggctccgccctcaagatggtctccaccgacgccgccgccgccgccgacgaacacgacgacgtcgccgccgccgccgacgtccacgcataa</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001048721.1 RefSeq:Os01g0177400]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 08:53, 8 May 2017

The rice Os01g0177400 was reported as OsGA3ox2 in 2003 [1] by researchers from Japan.

Annotated Information

Figure 4. Phenotype of D18:OsGA2ox1 transgenic rice.[1].

Gene Symbol

  • Os01g0177400 <=> GA3OX2, GA3ox1, OsGA3ox2, d18,OsD18

Function

  • OsGA3ox2 (D18) encodes GA 3-oxidase.
  • OsGA3ox2 is important in controlling bioactive GA synthesis for shoot elongation but not for reproductive development.

Phenotypic analysis

The rice d18 mutant is a severe GA-deficient dwarf, but its flower and grain development are not affected。

Expression

  • In wild-type rice, expression of OsGA3ox2 is regulated by the endogenous bioactive GA content.
  • Indeed, the OsGA3ox2 transcript was upregulated by uniconazole (an inhibitor of GA biosynthesis) treatment and downregulated by bioactive GA 3 application —as was the transcript of the green revolution rice gene, OsGA20ox2 (SD1), which encodes GA 20-oxidase 9.

You can also add sub-section(s) at will.

Knowledge Extension

  • Dwarfing is one of the most valuable traits in crop breeding, because it results in plants that are more resistant to damage by wind and rain (lodging resistant) and have stable increased yields.
  • Dwarf mutants have been extensively characterized in many plant species. The endogenous phytohormone GA is one of several factors associated with the dwarf phenotype.

Labs working on this gene

  • Field Production Science Center, The University of Tokyo, 1-1-1 Midoricyo, Nishi-Tokyo 188-0002, Japan.
  • National Institute of Agrobiological Sciences, 2-1-2 Kannondai, Tsukuba, Ibaraki 305-8602, Japan.
  • BioResource Center, RIKEN Tsukuba Institute, 3-1-1 Koyadai, Tsukuba, Ibaraki 305-0074, Japan.
  • Bioscience and Biotechnology Center, Nagoya University, Furocyo, Chikusa, Nagoya, Aichi 464-8601, Japan.
  • Institute of Agriculture and Forestry, University of Tsukuba, 1-1-1 Tennoudai, Tsukuba, Ibaraki 305-8572, Japan.

References

  1. 1.0 1.1 Sakamoto T, Morinaka Y, Ishiyama K, Kobayashi M, Itoh H, Kayano T, Iwahori S, Matsuoka M, Tanaka H. Genetic manipulation of gibberellin metabolism in transgenic rice. Nat Biotechnol. 2003 Aug;21(8):909-13. Epub 2003 Jul 13. PubMed PMID: 12858182.

Structured Information