Difference between revisions of "Os07g0129200"

From RiceWiki
Jump to: navigation, search
(References)
(References)
 
(20 intermediate revisions by 4 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os07g0129200''''' was reported as '''''PR1A''''' in 2000 by researchers from Japan.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os07g0129200''''' '''''<=>''''' '''''OsPR-1a,PR1a,OsPR1a'''''
 +
 
===Function===
 
===Function===
Please input function information here.
+
* Pathogenesis-related proteins(PR) have production/accumulation represents an essential component of the active plant defence repertoire.
 +
* And they have been used as markers of plant defense responses.
 +
* The dicot PR1 are recognized as reliable marker genes in defence/stress responses
 +
* Activation of '''''OsPR1a''''' gene is an important part of the defence/stress response(s) in rice.
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
* The '''''OsPR1a''''' gene was found to be cut-inducible, whereas the phytohormones JA, salicylic acid (SA), 3-indoleacetic acid, gibberellin, and ethylene (using ethylene generator ethephon, ET) enhanced accumulation of OsPR1a transcript, as well as the protein phosphatase inhibitors cantharidin (CN) and endothall (EN).
 +
* Induced expression of '''''OsPR1a''''' gene by JA, CN or EN, and ET was light/dark- and dose-dependent and was almost completely inhibited by cycloheximide.
 +
* Dark downregulated CN-, EN-, and ET-induced OsPR1a gene expression, whereas it was further enhanced with JA. SA and abscisic acid blocked JA-induced OsPR1a transcript.
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
* Southern analysis revealed that '''''OsPR1a''''' is a member of a multigene family.
 
 
You can also add sub-section(s) at will.
 
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* Research Laboratory for Agricultural Biotechnology and Biochemistry (RLABB), Kathmandu, GPO Box 8207, Nepal
 +
* Department of Agricultural Biology, College of Agriculture and Life Science, Seoul National University
 +
* Core Research for Evolutional Science and Technology (CREST), Honcho 4-1-8, Kawaguchi, Saitama 332, Japan
 +
* National Institute of Agrobiological Sciences (NIAS), Kannon-dai 2-1-2, Tsukuba, Ibaraki, 305-8602, Japan
  
 
==References==
 
==References==
Kamrun Nahar, Tina Kyndt, David De Vleesschauwer, Monica Hö, fte, Godelieve Gheysen.The Jasmonate Pathway Is a Key Player in Systemically Induced Defense against Root Knot Nematodes in Rice.Plant Physiology, 2011, 157(1): 305-316
+
* [1] Kamrun Nahar, Tina Kyndt, David De Vleesschauwer, Monica Hö, fte, Godelieve Gheysen.The Jasmonate Pathway Is a Key Player in Systemically Induced Defense against Root Knot Nematodes in Rice.Plant Physiology, 2011, 157(1): 305-316
 +
 
 +
* [2] Ichiro Mitsuhara; Takayoshi Iwai; Shigemi Seo; Yuki Yanagawa; Hiroyuki Kawahigasi; Sakino Hirose; Yasunobu Ohkawa; Yuko Ohashi.Characteristic expression of twelve rice PR1 family genes in response to pathogen infection, wounding, and defense-related signal compounds (121/180).Molecular Genetics and Genomics, 2008, 279(4): 415-427  DOI: 10.1007/s00438-008-0322-9
  
   
+
* [3] Ganesh Kumar Agrawal; Nam-Soo Jwa; Randeep Rakwal.A Novel Rice (Oryza sativa L.) Acidic PR1 Gene Highly Responsive to Cut, Phytohormones, and Protein Phosphatase Inhibitors.Biochemical and Biophysical Research Communications, 2000, 274(1): 157-165
Ichiro Mitsuhara; Takayoshi Iwai; Shigemi Seo; Yuki Yanagawa; Hiroyuki Kawahigasi; Sakino Hirose; Yasunobu Ohkawa; Yuko Ohashi.Characteristic expression of twelve rice PR1 family genes in response to pathogen infection, wounding, and defense-related signal compounds (121/180).Molecular Genetics and Genomics, 2008, 279(4): 415-427  DOI: 10.1007/s00438-008-0322-9
 
  
 +
* [4] Ganesh Kumar Agrawala§, Randeep Rakwalb§‡*, Nam-Soo Jwac, Vishwanath Prasad Agrawala.Signalling molecules and blast pathogen attack activates rice OsPR1a and OsPR1b genes: A model illustrating omponents participating during defence/stress response.Plant Physiol. Biochem. 39 (2001) 1095−1103
  
Ganesh Kumar Agrawal; Nam-Soo Jwa; Randeep Rakwal.A Novel Rice (Oryza sativa L.) Acidic PR1 Gene Highly Responsive to Cut, Phytohormones, and Protein Phosphatase Inhibitors.Biochemical and Biophysical Research Communications, 2000, 274(1): 157-165
+
* [5] Ganesh Kumar Agrawal,*,1 Nam-Soo Jwa,† and Randeep Rakwal. A Novel Rice (Oryza sativa L.) Acidic PR1 Gene Highly Responsive to Cut, Phytohormones,and Protein Phosphatase Inhibitors. Biochemical and Biophysical Research Communications 274, 157–165 (2000)
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os07g0129200|
 
Description = PR1a protein|
 
Version = NM_001065350.1 GI:115470432 GeneID:4342317|
 
Length = 792 bp|
 
Definition = Oryza sativa Japonica Group Os07g0129200, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 7|Chromosome 7]]|
 
AP = Chromosome 7:1544202..1544993|
 
CDS = 1544290..1544796|
 
GCID = <gbrowseImage1>
 
name=NC_008400:1544202..1544993
 
source=RiceChromosome07
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008400:1544202..1544993
 
source=RiceChromosome07
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggcgagttcgtcgagcaggttatcctgctgcttgctggtgctcgcggcggcggccatggcggcgacggcgcagaactcggcgcaggacttcgtggacccgcacaacgcggcgagggccgacgtcggggtggggccggtgagctgggacgacacggtggcggcgtacgcggagagctacgcggcgcagcggcagggcgactgcaagctggagcactcggactccggcgggaagtacggcgagaacatcttctggggctccgccggcggcgactggacggcggcgagcgccgtgtcggcgtgggtgtcggagaagcagtggtacgaccacggcagcaacagctgctcggcgccggaggggagctcgtgcgggcactacacgcaggtggtgtggcgcgactcgacggcgatcggctgcgcccgcgtcgtctgcgacggcgacctcggcgtcttcatcacctgcaactactcgccgccgggcaacttcgtcggccaatctccctactga</cdnaseq>|
 
AA = <aaseq>MASSSSRLSCCLLVLAAAAMAATAQNSAQDFVDPHNAARADVGV                    GPVSWDDTVAAYAESYAAQRQGDCKLEHSDSGGKYGENIFWGSAGGDWTAASAVSAWV                    SEKQWYDHGSNSCSAPEGSSCGHYTQVVWRDSTAIGCARVVCDGDLGVFITCNYSPPG                    NFVGQSPY</aaseq>|
 
DNA = <dnaseqindica>89..595#tcgatctccatcatctcttcgtctactaacaaagttataatatcaaattaaggtatatatatatatatatagtagctagcttcaattaatggcgagttcgtcgagcaggttatcctgctgcttgctggtgctcgcggcggcggccatggcggcgacggcgcagaactcggcgcaggacttcgtggacccgcacaacgcggcgagggccgacgtcggggtggggccggtgagctgggacgacacggtggcggcgtacgcggagagctacgcggcgcagcggcagggcgactgcaagctggagcactcggactccggcgggaagtacggcgagaacatcttctggggctccgccggcggcgactggacggcggcgagcgccgtgtcggcgtgggtgtcggagaagcagtggtacgaccacggcagcaacagctgctcggcgccggaggggagctcgtgcgggcactacacgcaggtggtgtggcgcgactcgacggcgatcggctgcgcccgcgtcgtctgcgacggcgacctcggcgtcttcatcacctgcaactactcgccgccgggcaacttcgtcggccaatctccctactgattaattaattaattatattatcacactcactaattaatcatatcgtatgctatgctacgtgtttatgcatgtatggacatgtagtgtcatatggtatatcgtatatgtgtacgtataatatacgtacgtatgctggtgagaataaatccgatgaataaataaataaagctgtactgtcagccgtatttgcttagtgt</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001065350.1 RefSeq:Os07g0129200]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 09:26, 8 May 2017

The rice Os07g0129200 was reported as PR1A in 2000 by researchers from Japan.

Annotated Information

Gene Symbol

  • Os07g0129200 <=> OsPR-1a,PR1a,OsPR1a

Function

  • Pathogenesis-related proteins(PR) have production/accumulation represents an essential component of the active plant defence repertoire.
  • And they have been used as markers of plant defense responses.
  • The dicot PR1 are recognized as reliable marker genes in defence/stress responses
  • Activation of OsPR1a gene is an important part of the defence/stress response(s) in rice.

Expression

  • The OsPR1a gene was found to be cut-inducible, whereas the phytohormones JA, salicylic acid (SA), 3-indoleacetic acid, gibberellin, and ethylene (using ethylene generator ethephon, ET) enhanced accumulation of OsPR1a transcript, as well as the protein phosphatase inhibitors cantharidin (CN) and endothall (EN).
  • Induced expression of OsPR1a gene by JA, CN or EN, and ET was light/dark- and dose-dependent and was almost completely inhibited by cycloheximide.
  • Dark downregulated CN-, EN-, and ET-induced OsPR1a gene expression, whereas it was further enhanced with JA. SA and abscisic acid blocked JA-induced OsPR1a transcript.

Evolution

  • Southern analysis revealed that OsPR1a is a member of a multigene family.

Labs working on this gene

  • Research Laboratory for Agricultural Biotechnology and Biochemistry (RLABB), Kathmandu, GPO Box 8207, Nepal
  • Department of Agricultural Biology, College of Agriculture and Life Science, Seoul National University
  • Core Research for Evolutional Science and Technology (CREST), Honcho 4-1-8, Kawaguchi, Saitama 332, Japan
  • National Institute of Agrobiological Sciences (NIAS), Kannon-dai 2-1-2, Tsukuba, Ibaraki, 305-8602, Japan

References

  • [1] Kamrun Nahar, Tina Kyndt, David De Vleesschauwer, Monica Hö, fte, Godelieve Gheysen.The Jasmonate Pathway Is a Key Player in Systemically Induced Defense against Root Knot Nematodes in Rice.Plant Physiology, 2011, 157(1): 305-316
  • [2] Ichiro Mitsuhara; Takayoshi Iwai; Shigemi Seo; Yuki Yanagawa; Hiroyuki Kawahigasi; Sakino Hirose; Yasunobu Ohkawa; Yuko Ohashi.Characteristic expression of twelve rice PR1 family genes in response to pathogen infection, wounding, and defense-related signal compounds (121/180).Molecular Genetics and Genomics, 2008, 279(4): 415-427 DOI: 10.1007/s00438-008-0322-9
  • [3] Ganesh Kumar Agrawal; Nam-Soo Jwa; Randeep Rakwal.A Novel Rice (Oryza sativa L.) Acidic PR1 Gene Highly Responsive to Cut, Phytohormones, and Protein Phosphatase Inhibitors.Biochemical and Biophysical Research Communications, 2000, 274(1): 157-165
  • [4] Ganesh Kumar Agrawala§, Randeep Rakwalb§‡*, Nam-Soo Jwac, Vishwanath Prasad Agrawala.Signalling molecules and blast pathogen attack activates rice OsPR1a and OsPR1b genes: A model illustrating omponents participating during defence/stress response.Plant Physiol. Biochem. 39 (2001) 1095−1103
  • [5] Ganesh Kumar Agrawal,*,1 Nam-Soo Jwa,† and Randeep Rakwal. A Novel Rice (Oryza sativa L.) Acidic PR1 Gene Highly Responsive to Cut, Phytohormones,and Protein Phosphatase Inhibitors. Biochemical and Biophysical Research Communications 274, 157–165 (2000)

Structured Information