Difference between revisions of "Os07g0129200"

From RiceWiki
Jump to: navigation, search
(Evolution)
(References)
 
(17 intermediate revisions by 4 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os07g0129200''''' was reported as '''''PR1A''''' in 2000 by researchers from Japan.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os07g0129200''''' '''''<=>''''' '''''OsPR-1a,PR1a,OsPR1a'''''
 +
 
===Function===
 
===Function===
Pathogenesis-related proteins have production/accumulation represents an essential component of the active plant defence repertoire.They are defined as plant proteins that are induced specifically in pathological or related situations.Activation of OsPR1 genes is an important part of the defence/stress response(s) in rice.
+
* Pathogenesis-related proteins(PR) have production/accumulation represents an essential component of the active plant defence repertoire.
 
+
* And they have been used as markers of plant defense responses.
 
+
* The dicot PR1 are recognized as reliable marker genes in defence/stress responses
 +
* Activation of '''''OsPR1a''''' gene is an important part of the defence/stress response(s) in rice.
  
 
===Expression===
 
===Expression===
OsPR1a and OsPR1b genes were primarily characterized against jasmonic acid, ethylene and protein phosphatase 2A inhibitors. The dicot PR1 are recognized as reliable marker genes in defence/stress responses.SA, ABA and H2O2 up-regulate the expression of OsPR1a and OsPR1b genes(fig1)
+
* The '''''OsPR1a''''' gene was found to be cut-inducible, whereas the phytohormones JA, salicylic acid (SA), 3-indoleacetic acid, gibberellin, and ethylene (using ethylene generator ethephon, ET) enhanced accumulation of OsPR1a transcript, as well as the protein phosphatase inhibitors cantharidin (CN) and endothall (EN).  
(fig2).
+
* Induced expression of '''''OsPR1a''''' gene by JA, CN or EN, and ET was light/dark- and dose-dependent and was almost completely inhibited by cycloheximide.  
 
+
* Dark downregulated CN-, EN-, and ET-induced OsPR1a gene expression, whereas it was further enhanced with JA. SA and abscisic acid blocked JA-induced OsPR1a transcript.
 
 
[[File:Expression of OsPR1 influenced.JPG]]
 
 
 
 
 
fig1:The expression of OsPR1a and OsPR1b genes influenced by SA, ABA and H2O2
 
 
 
 
 
 
 
[[File:Expression of OsPR1 influenced by SA.JPG]]
 
 
 
 
 
 
 
fig2:The progress of OsPR1a and OsPR1b genes expression influenced by SA, ABA and H2O2
 
  
 
===Evolution===
 
===Evolution===
Alignment of the deduced rice PR1 protein sequence (OsPR1a) with homologous sequences(fig3). The most homologous monocot sequences were identified by database searches with the Blast algorithm, whereas the Arabidopsis thaliana and tobacco sequences are shown as examples of dicot PR1 genes.An arrowhead indicates the putative processing site and boxes indicate the consensus regions I and II. Asterisks represent identical amino acid residues and dashes indicate gaps introduced to optimize alignment.
+
* Southern analysis revealed that '''''OsPR1a''''' is a member of a multigene family.
 
 
 
 
[[File:Homologous sequences.JPG]]
 
 
 
 
 
 
 
fig3:Rice PR1 protein sequence (OsPR1a) with homologous sequences
 
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* Research Laboratory for Agricultural Biotechnology and Biochemistry (RLABB), Kathmandu, GPO Box 8207, Nepal
 +
* Department of Agricultural Biology, College of Agriculture and Life Science, Seoul National University
 +
* Core Research for Evolutional Science and Technology (CREST), Honcho 4-1-8, Kawaguchi, Saitama 332, Japan
 +
* National Institute of Agrobiological Sciences (NIAS), Kannon-dai 2-1-2, Tsukuba, Ibaraki, 305-8602, Japan
  
 
==References==
 
==References==
Kamrun Nahar, Tina Kyndt, David De Vleesschauwer, Monica Hö, fte, Godelieve Gheysen.The Jasmonate Pathway Is a Key Player in Systemically Induced Defense against Root Knot Nematodes in Rice.Plant Physiology, 2011, 157(1): 305-316
+
* [1] Kamrun Nahar, Tina Kyndt, David De Vleesschauwer, Monica Hö, fte, Godelieve Gheysen.The Jasmonate Pathway Is a Key Player in Systemically Induced Defense against Root Knot Nematodes in Rice.Plant Physiology, 2011, 157(1): 305-316
 +
 
 +
* [2] Ichiro Mitsuhara; Takayoshi Iwai; Shigemi Seo; Yuki Yanagawa; Hiroyuki Kawahigasi; Sakino Hirose; Yasunobu Ohkawa; Yuko Ohashi.Characteristic expression of twelve rice PR1 family genes in response to pathogen infection, wounding, and defense-related signal compounds (121/180).Molecular Genetics and Genomics, 2008, 279(4): 415-427  DOI: 10.1007/s00438-008-0322-9
  
   
+
* [3] Ganesh Kumar Agrawal; Nam-Soo Jwa; Randeep Rakwal.A Novel Rice (Oryza sativa L.) Acidic PR1 Gene Highly Responsive to Cut, Phytohormones, and Protein Phosphatase Inhibitors.Biochemical and Biophysical Research Communications, 2000, 274(1): 157-165
Ichiro Mitsuhara; Takayoshi Iwai; Shigemi Seo; Yuki Yanagawa; Hiroyuki Kawahigasi; Sakino Hirose; Yasunobu Ohkawa; Yuko Ohashi.Characteristic expression of twelve rice PR1 family genes in response to pathogen infection, wounding, and defense-related signal compounds (121/180).Molecular Genetics and Genomics, 2008, 279(4): 415-427  DOI: 10.1007/s00438-008-0322-9
 
  
 +
* [4] Ganesh Kumar Agrawala§, Randeep Rakwalb§‡*, Nam-Soo Jwac, Vishwanath Prasad Agrawala.Signalling molecules and blast pathogen attack activates rice OsPR1a and OsPR1b genes: A model illustrating omponents participating during defence/stress response.Plant Physiol. Biochem. 39 (2001) 1095−1103
  
Ganesh Kumar Agrawal; Nam-Soo Jwa; Randeep Rakwal.A Novel Rice (Oryza sativa L.) Acidic PR1 Gene Highly Responsive to Cut, Phytohormones, and Protein Phosphatase Inhibitors.Biochemical and Biophysical Research Communications, 2000, 274(1): 157-165
+
* [5] Ganesh Kumar Agrawal,*,1 Nam-Soo Jwa,† and Randeep Rakwal. A Novel Rice (Oryza sativa L.) Acidic PR1 Gene Highly Responsive to Cut, Phytohormones,and Protein Phosphatase Inhibitors. Biochemical and Biophysical Research Communications 274, 157–165 (2000)
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os07g0129200|
 
Description = PR1a protein|
 
Version = NM_001065350.1 GI:115470432 GeneID:4342317|
 
Length = 792 bp|
 
Definition = Oryza sativa Japonica Group Os07g0129200, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 7|Chromosome 7]]|
 
AP = Chromosome 7:1544202..1544993|
 
CDS = 1544290..1544796|
 
GCID = <gbrowseImage1>
 
name=NC_008400:1544202..1544993
 
source=RiceChromosome07
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008400:1544202..1544993
 
source=RiceChromosome07
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggcgagttcgtcgagcaggttatcctgctgcttgctggtgctcgcggcggcggccatggcggcgacggcgcagaactcggcgcaggacttcgtggacccgcacaacgcggcgagggccgacgtcggggtggggccggtgagctgggacgacacggtggcggcgtacgcggagagctacgcggcgcagcggcagggcgactgcaagctggagcactcggactccggcgggaagtacggcgagaacatcttctggggctccgccggcggcgactggacggcggcgagcgccgtgtcggcgtgggtgtcggagaagcagtggtacgaccacggcagcaacagctgctcggcgccggaggggagctcgtgcgggcactacacgcaggtggtgtggcgcgactcgacggcgatcggctgcgcccgcgtcgtctgcgacggcgacctcggcgtcttcatcacctgcaactactcgccgccgggcaacttcgtcggccaatctccctactga</cdnaseq>|
 
AA = <aaseq>MASSSSRLSCCLLVLAAAAMAATAQNSAQDFVDPHNAARADVGV                    GPVSWDDTVAAYAESYAAQRQGDCKLEHSDSGGKYGENIFWGSAGGDWTAASAVSAWV                    SEKQWYDHGSNSCSAPEGSSCGHYTQVVWRDSTAIGCARVVCDGDLGVFITCNYSPPG                    NFVGQSPY</aaseq>|
 
DNA = <dnaseqindica>89..595#tcgatctccatcatctcttcgtctactaacaaagttataatatcaaattaaggtatatatatatatatatagtagctagcttcaattaatggcgagttcgtcgagcaggttatcctgctgcttgctggtgctcgcggcggcggccatggcggcgacggcgcagaactcggcgcaggacttcgtggacccgcacaacgcggcgagggccgacgtcggggtggggccggtgagctgggacgacacggtggcggcgtacgcggagagctacgcggcgcagcggcagggcgactgcaagctggagcactcggactccggcgggaagtacggcgagaacatcttctggggctccgccggcggcgactggacggcggcgagcgccgtgtcggcgtgggtgtcggagaagcagtggtacgaccacggcagcaacagctgctcggcgccggaggggagctcgtgcgggcactacacgcaggtggtgtggcgcgactcgacggcgatcggctgcgcccgcgtcgtctgcgacggcgacctcggcgtcttcatcacctgcaactactcgccgccgggcaacttcgtcggccaatctccctactgattaattaattaattatattatcacactcactaattaatcatatcgtatgctatgctacgtgtttatgcatgtatggacatgtagtgtcatatggtatatcgtatatgtgtacgtataatatacgtacgtatgctggtgagaataaatccgatgaataaataaataaagctgtactgtcagccgtatttgcttagtgt</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001065350.1 RefSeq:Os07g0129200]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 09:26, 8 May 2017

The rice Os07g0129200 was reported as PR1A in 2000 by researchers from Japan.

Annotated Information

Gene Symbol

  • Os07g0129200 <=> OsPR-1a,PR1a,OsPR1a

Function

  • Pathogenesis-related proteins(PR) have production/accumulation represents an essential component of the active plant defence repertoire.
  • And they have been used as markers of plant defense responses.
  • The dicot PR1 are recognized as reliable marker genes in defence/stress responses
  • Activation of OsPR1a gene is an important part of the defence/stress response(s) in rice.

Expression

  • The OsPR1a gene was found to be cut-inducible, whereas the phytohormones JA, salicylic acid (SA), 3-indoleacetic acid, gibberellin, and ethylene (using ethylene generator ethephon, ET) enhanced accumulation of OsPR1a transcript, as well as the protein phosphatase inhibitors cantharidin (CN) and endothall (EN).
  • Induced expression of OsPR1a gene by JA, CN or EN, and ET was light/dark- and dose-dependent and was almost completely inhibited by cycloheximide.
  • Dark downregulated CN-, EN-, and ET-induced OsPR1a gene expression, whereas it was further enhanced with JA. SA and abscisic acid blocked JA-induced OsPR1a transcript.

Evolution

  • Southern analysis revealed that OsPR1a is a member of a multigene family.

Labs working on this gene

  • Research Laboratory for Agricultural Biotechnology and Biochemistry (RLABB), Kathmandu, GPO Box 8207, Nepal
  • Department of Agricultural Biology, College of Agriculture and Life Science, Seoul National University
  • Core Research for Evolutional Science and Technology (CREST), Honcho 4-1-8, Kawaguchi, Saitama 332, Japan
  • National Institute of Agrobiological Sciences (NIAS), Kannon-dai 2-1-2, Tsukuba, Ibaraki, 305-8602, Japan

References

  • [1] Kamrun Nahar, Tina Kyndt, David De Vleesschauwer, Monica Hö, fte, Godelieve Gheysen.The Jasmonate Pathway Is a Key Player in Systemically Induced Defense against Root Knot Nematodes in Rice.Plant Physiology, 2011, 157(1): 305-316
  • [2] Ichiro Mitsuhara; Takayoshi Iwai; Shigemi Seo; Yuki Yanagawa; Hiroyuki Kawahigasi; Sakino Hirose; Yasunobu Ohkawa; Yuko Ohashi.Characteristic expression of twelve rice PR1 family genes in response to pathogen infection, wounding, and defense-related signal compounds (121/180).Molecular Genetics and Genomics, 2008, 279(4): 415-427 DOI: 10.1007/s00438-008-0322-9
  • [3] Ganesh Kumar Agrawal; Nam-Soo Jwa; Randeep Rakwal.A Novel Rice (Oryza sativa L.) Acidic PR1 Gene Highly Responsive to Cut, Phytohormones, and Protein Phosphatase Inhibitors.Biochemical and Biophysical Research Communications, 2000, 274(1): 157-165
  • [4] Ganesh Kumar Agrawala§, Randeep Rakwalb§‡*, Nam-Soo Jwac, Vishwanath Prasad Agrawala.Signalling molecules and blast pathogen attack activates rice OsPR1a and OsPR1b genes: A model illustrating omponents participating during defence/stress response.Plant Physiol. Biochem. 39 (2001) 1095−1103
  • [5] Ganesh Kumar Agrawal,*,1 Nam-Soo Jwa,† and Randeep Rakwal. A Novel Rice (Oryza sativa L.) Acidic PR1 Gene Highly Responsive to Cut, Phytohormones,and Protein Phosphatase Inhibitors. Biochemical and Biophysical Research Communications 274, 157–165 (2000)

Structured Information