Difference between revisions of "Os12g0100500"

From RiceWiki
Jump to: navigation, search
(Created page with "{{JaponicaGene| GeneName = Os12g0100500| Description = Alpha/beta hydrolase family protein| Version = NM_001071764.1 GI:115486849 GeneID:4351238| Length = 1294 bp| Defini...")
 
 
(6 intermediate revisions by 4 users not shown)
Line 1: Line 1:
{{JaponicaGene|
+
The rice gene '''''Os12g0100500''''' was not functionally studied yet.
GeneName = Os12g0100500|
+
 
Description = Alpha/beta hydrolase family protein|
+
==Annotated Information==
Version = NM_001071764.1 GI:115486849 GeneID:4351238|
+
* ''Os12g0100500'' in rice hasn't been studied. However, by running blast, we can find that query coverage is 100% with predicted protein.
Length = 1294 bp|
+
* This gene is predicted to be coding Lysophospholipase [Lipid metabolism]; COG2267. 
Definition = Oryza sativa Japonica Group Os12g0100500, complete gene.|
+
===Gene Symbol===
Source = Oryza sativa Japonica Group
+
*'''''Os12g0100500''''' '''''<=>''''' '''''COG2267, OsCOG2267'''''
 +
 
 +
===Function===
 +
* In enzymology, a lysophospholipase (EC 3.1.1.5) is an enzyme that catalyzes the chemical reaction
 +
* 2-lysophosphatidylcholine + H2O \rightleftharpoons glycerophosphocholine + a carboxylate
 +
* Thus, the two substrates of this enzyme are 2-lysophosphatidylcholine and H2O, whereas its two products are glycerophosphocholine and carboxylate.
 +
* This enzyme belongs to the family of hydrolases, specifically those acting on carboxylic ester bonds.
 +
 
 +
===Evolution===
 +
* This family consists of lysophospholipase / phospholipase B EC 3.1.1.5 and cytosolic phospholipase A2 which also has a C2 domain IPR000008.
 +
* Phospholipase B enzymes catalyse the release of fatty acids from lysophospholipids and are capable in vitro of hydrolyzing all phospholipids extractable from yeast cells.
 +
* Cytosolic phospholipase A2 associates with natural membranes in response to physiological increases in Ca2+ and selectively hydrolyses arachidonyl phospholipids,
 +
* the aligned region corresponds the carboxy-terminal Ca2+-independent catalytic domain of the protein as discussed in.
 +
 
 +
You can also add sub-section(s) at will.
 +
 
 +
==Labs working on this gene==
 +
Please input related labs here.
 +
 
 +
==References==
 +
* [1] Nalefski EA, Sultzman LA, Martin DM, Kriz RW, Towler PS, Knopf JL, Clark JD (1994). "Delineation of two functionally distinct domains of cytosolic phospholipase A2, a regulatory Ca(2+)-dependent lipid-binding domain and a Ca(2+)-independent catalytic domain". J. Biol. Chem. 269 (27): 18239–18249. PMID 8027085.
 +
* [2]Jump up to: a b Lee KS, Patton JL, Fido M, Hines LK, Kohlwein SD, Paltauf F, Henry SA, Levin DE (1994). "The Saccharomyces cerevisiae PLB1 gene encodes a protein required for lysophospholipase and phospholipase B activity". J. Biol. Chem. 269 (31): 19725–19730. PMID 8051052.
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 12|Chromosome 12]]|
 
AP = Chromosome 12:11806..13099|
 
CDS = 11806..12363,12659..13099|
 
GCID = <gbrowseImage1>
 
name=NC_008405:11806..13099
 
source=RiceChromosome12
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008405:11806..13099
 
source=RiceChromosome12
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atgagcagcagcagcggcggcgatgggggtgggtacaattactcggaggattgggtggtgaattcgcgagggatgcggctcttcacctgcgcgtggattcccaaggagagcagtagaggcgtggtttgcctgtgccatgggtacgcggtggagtgcagcgtgacgatgcgcggcacggcggagcggctggccagggcgggctacgccgtccacggcatcgactacgagggccacggccactccgacggcctccagggctacgtccccgacctcgacgccctcgtccgcgactgcgactccttcttctccaccgccaccgcctccttcccccgccgcagattcctcctcggcgagtccatgggcggcgccgtcgcccttcttctccaccgcttgcgccccgacttctggaccggcgccattctcgtcgcccccatgtgcaagatcgcggaggagatgcggccgcacccgatggtggtgagcgtgctgaaggtgatgacaagcatcataccgacgtggcgggtggtgccgacgaatgacgtgatcgacctggcatacaggatgcaggggaagcgagacgagatccgagggaacccactgtgctacaagggcaggccccgcctcaagaccgcctacgagctgctccgcgtcagcatcctcatcgagtccaccatcctcccccacgtctccctccccttcctcatcctccacggcgccgccgaccgggtcaccgacccctccgtcagcgacctcctctaccgctccgcctccaccaccgacaagaccttccacctctacaccggcatgtggcacgccctcacctccggcgaactccctcacaacatcgatgccgtcttccgcgacatcatcgactggctccaccacaggacatcccccacctccgcttcacatgtgcaggaccacgacttaagtacgtctttcgaggcggagcgcaaggccaagcacgacgacaccatccattgcggcaagcaaacatcatag</cdnaseq>|
 
AA = <aaseq>MSSSSGGDGGGYNYSEDWVVNSRGMRLFTCAWIPKESSRGVVCL                    CHGYAVECSVTMRGTAERLARAGYAVHGIDYEGHGHSDGLQGYVPDLDALVRDCDSFF                    STATASFPRRRFLLGESMGGAVALLLHRLRPDFWTGAILVAPMCKIAEEMRPHPMVVS                    VLKVMTSIIPTWRVVPTNDVIDLAYRMQGKRDEIRGNPLCYKGRPRLKTAYELLRVSI                    LIESTILPHVSLPFLILHGAADRVTDPSVSDLLYRSASTTDKTFHLYTGMWHALTSGE                    LPHNIDAVFRDIIDWLHHRTSPTSASHVQDHDLSTSFEAERKAKHDDTIHCGKQTS</aaseq>|
 
DNA = <dnaseqindica>737..1294#1..441#atgagcagcagcagcggcggcgatgggggtgggtacaattactcggaggattgggtggtgaattcgcgagggatgcggctcttcacctgcgcgtggattcccaaggagagcagtagaggcgtggtttgcctgtgccatgggtacgcggtggagtgcagcgtgacgatgcgcggcacggcggagcggctggccagggcgggctacgccgtccacggcatcgactacgagggccacggccactccgacggcctccagggctacgtccccgacctcgacgccctcgtccgcgactgcgactccttcttctccaccgccaccgcctccttcccccgccgcagattcctcctcggcgagtccatgggcggcgccgtcgcccttcttctccaccgcttgcgccccgacttctggaccggcgccattctcgtcgcccccatgtgcaaggtccgttcaactccatcttaacctttgactctgacttttcctttttctttttgcccgccacatgcatgccatccacgaatcattcagtctacatatgcgtccccaagattagattagatatttagattatactacataacagaacaggctgtctctttctcattttctaagctacctaccggccggccactttcagattattatcttcttttaacgcaacgcaaggaaacgtttctgactgcctcaaatatcatggatgcatgtggttgaatactagtaaaatgcgtggttgcagatcgcggaggagatgcggccgcacccgatggtggtgagcgtgctgaaggtgatgacaagcatcataccgacgtggcgggtggtgccgacgaatgacgtgatcgacctggcatacaggatgcaggggaagcgagacgagatccgagggaacccactgtgctacaagggcaggccccgcctcaagaccgcctacgagctgctccgcgtcagcatcctcatcgagtccaccatcctcccccacgtctccctccccttcctcatcctccacggcgccgccgaccgggtcaccgacccctccgtcagcgacctcctctaccgctccgcctccaccaccgacaagaccttccacctctacaccggcatgtggcacgccctcacctccggcgaactccctcacaacatcgatgccgtcttccgcgacatcatcgactggctccaccacaggacatcccccacctccgcttcacatgtgcaggaccacgacttaagtacgtctttcgaggcggagcgcaaggccaagcacgacgacaccatccattgcggcaagcaaacatcatag</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001071764.1 RefSeq:Os12g0100500]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]
Line 36: Line 34:
 
[[Category:Japonica Chromosome 12]]
 
[[Category:Japonica Chromosome 12]]
 
[[Category:Chromosome 12]]
 
[[Category:Chromosome 12]]
 +
== Structured Information ==

Latest revision as of 09:29, 8 May 2017

The rice gene Os12g0100500 was not functionally studied yet.

Annotated Information

  • Os12g0100500 in rice hasn't been studied. However, by running blast, we can find that query coverage is 100% with predicted protein.
  • This gene is predicted to be coding Lysophospholipase [Lipid metabolism]; COG2267.

Gene Symbol

  • Os12g0100500 <=> COG2267, OsCOG2267

Function

  • In enzymology, a lysophospholipase (EC 3.1.1.5) is an enzyme that catalyzes the chemical reaction
  • 2-lysophosphatidylcholine + H2O \rightleftharpoons glycerophosphocholine + a carboxylate
  • Thus, the two substrates of this enzyme are 2-lysophosphatidylcholine and H2O, whereas its two products are glycerophosphocholine and carboxylate.
  • This enzyme belongs to the family of hydrolases, specifically those acting on carboxylic ester bonds.

Evolution

  • This family consists of lysophospholipase / phospholipase B EC 3.1.1.5 and cytosolic phospholipase A2 which also has a C2 domain IPR000008.
  • Phospholipase B enzymes catalyse the release of fatty acids from lysophospholipids and are capable in vitro of hydrolyzing all phospholipids extractable from yeast cells.
  • Cytosolic phospholipase A2 associates with natural membranes in response to physiological increases in Ca2+ and selectively hydrolyses arachidonyl phospholipids,
  • the aligned region corresponds the carboxy-terminal Ca2+-independent catalytic domain of the protein as discussed in.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

  • [1] Nalefski EA, Sultzman LA, Martin DM, Kriz RW, Towler PS, Knopf JL, Clark JD (1994). "Delineation of two functionally distinct domains of cytosolic phospholipase A2, a regulatory Ca(2+)-dependent lipid-binding domain and a Ca(2+)-independent catalytic domain". J. Biol. Chem. 269 (27): 18239–18249. PMID 8027085.
  • [2]Jump up to: a b Lee KS, Patton JL, Fido M, Hines LK, Kohlwein SD, Paltauf F, Henry SA, Levin DE (1994). "The Saccharomyces cerevisiae PLB1 gene encodes a protein required for lysophospholipase and phospholipase B activity". J. Biol. Chem. 269 (31): 19725–19730. PMID 8051052.

Structured Information