Difference between revisions of "Os02g0552700"

From RiceWiki
Jump to: navigation, search
(Annotated Information)
 
(12 intermediate revisions by 4 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os06g0493100''''' was reported as '''''OsZFP6''''' in 2014 <ref name="ref1" /> by researchers from China.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
[[File:23-Os12g0100500.png|right|thumb|327px|'''Fig. 3. Subcellular localisation of the 35S::OsZFP6::GFP fusion protein..<ref name="ref1" />.''']]
 
===Function===
 
===Function===
This gene encodes a novel CCHC-type zinc finger pronein called OsZFP6. OsZFP6 is structurally and functionally conserved, mainly localised in nucleus, and can play an important role in stress tolerance responses to salt (NaCl), alkali (NaHCO<sub>3</sub>), and H<sub>2</sub>O<sub>2</sub> treatment in rice. Functional analysis also showed overexpression of this gene in transgenic <i>Arabidopsis</i> and yeast to NaHCO<sub>3</sub> and H<sub>2</sub>O<sub>2</sub>.
+
* '''''OsZFP6''''' is a putatively useful gene for developing crops with increased alkali and H2O2 tolerance.
 +
* '''''OsZFP6''''' plays an important role in abiotic stress responses.<ref name="ref1" />
  
===Construction===
+
===Phenotypic analysis===
The <i>OsZFP6</i> gene is a single-copy gene in the rice genome. It is 1559 bp in length with a 458 bp 5' UTR and a 186 bp 3' UTR. The ORF encodes a 304 amino acid with a molecular weight of 33.6 kDa and an isoelectric point of 7.35. Based on structural properties indicated by the SMART programs, the predicted protein contains two conserved domains: a Pfam retrotrans-gag domain from amino acid 48 to 146 and a ZnF C2HC domain from amino acid 216 to 232.
+
* When OsZFP6 was transformed into yeast, the transgenic yeast showed significantly increased resistance to NaHCO3 compared to the control. * Moreover, Arabidopsis transgenic plants overexpressing ''''OsZFP6''''' were more tolerant to both NaHCO3 and H2O2 treatments.
  
 
===Expression===
 
===Expression===
Using the online analysis tool Psort to predict the subcellular localisation of rice OsZFP6, OsZFP6 was localised to the nucleus with a 73.9% probability. To validate the predicted result, a PBI121-<i>OsZFP6</i>:<i>GFP</i> plasmid was transformed into onion epidermal cells. After culture for 18-24 h in the dark, green fluorescence was observed in the nucleus (as shown in figure), suggesting the OsZFP6 protein, driven by the 35S promoter, was localized in the nucleus.
+
* '''''OsZFP6''''' expression was increased by abiotic stress, including salt (NaCl), alkali (NaHCO 3 ) and H2O2 treatment
Tissue distribution of <i>OsZFP6</i> gene expression is still unknown yet.
 
  
===Evolution===
+
===Subcellular localization===
The CysCysHisCys (CCHC)-type zinc finger domains contain the sequence C-X2-C-X4-H-X4-C, where X can be any amino acid, and the numbers indicate the number of residues. This domain is conserved in <i>Arabidopsis</i>, yeast and rice, as shown in table.
+
* The '''''OsZFP6''''' protein contains 305 amino acids and a conserved zinc finger domain and is localised to the nucleus.
 +
 
 +
You can also add sub-section(s) at will.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* Northeast Institute of Geography and Agroecology, Key Laboratory of Soybean Molecular Design Breeding, Chinese Academy of Sciences, Harbin,Heilongjiang 150081, China
 
+
* Key Laboratory of Biology and Genetic Resources of Rubber Tree, Ministry of Agriculture, State Key Laboratory Incubation Base for Cultivation and Physiology of Tropical Crops, Rubber Research Institute, CATAS, Danzhou, Hainan 571737, China
 +
* Alkali Soil Natural Environmental Science Center (ASNESC), Northeast Forestry University, Harbin, Heilongjiang 150040, China College of Life Sciences, Xinyang Normal University, China.
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Zhang K, Qian Q, Huang Z, Wang Y, Li M, Hong L, Zeng D, Gu M, Chu C, Cheng Z.  
 +
GOLD HULL AND INTERNODE2 encodes a primarily multifunctional cinnamyl-alcohol
 +
dehydrogenase in rice. Plant Physiol. 2006 Mar;140(3):972-83. Epub 2006 Jan 27.
 +
PubMed PMID: 16443696; PubMed Central PMCID: PMC1400561.
 +
</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os02g0552700|
 
Description = Zinc finger, CCHC-type domain containing protein|
 
Version = NM_001053643.1 GI:115446656 GeneID:4329640|
 
Length = 1559 bp|
 
Definition = Oryza sativa Japonica Group Os02g0552700, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
 
AP = Chromosome 2:21704297..21705855|
 
CDS = 21704755..21705669|
 
GCID = <gbrowseImage1>
 
name=NC_008395:21704297..21705855
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008395:21704297..21705855
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atgcttttgaggtcgattggtcaagcatctcacctcacagatgatcctcctgatgagaaaacggatgcaactaaaattaaggcgtggaaaacagcagatgatcgtgttatgggattcatattcatgagtgtagaggtgcctattcggatgagtttcagggatcacactaccgctaaagagatgtgggactacctcaaacagaggtacactcaagaaagcggagctttgcgtttttccttgctgcagaatttgcacaacttacaacaacaagatcagtccattgaagaattttataatgcctttactcggttgtctggacagcttgaggcacagactccaaaaggtgcttcaggttgtgcacaatgcaaggcgagagagaagcatgatcaagaaaatctagtgtatcaatttgtcatgagactttcctctcaatttgagtccattcgagttcagttgcttggacgtcctacacgtcctactatggcggaggctcttgcagatctaatcgctgaggagacacgtctttgttccttggacactactcctactcctgtggttactcacaatgtcatggcagcacctcagcgtgttggagctcctatgggcgggatccctgaattcagttccatcgccaaaagtgatcgtatttgctctcattgcaagaaggttggacatatttccgatgattgcttctatcttcatccagagaagttggctgattatcaagctaggcgtgcagcggtcccccgtcctcgtgcgacggctagtgctcctgttttcttggatatcactgctgctggtccttctagtactagtgctggtggcagtgcctctagcgccgtctcatgtgctcctcagtcattggttgcaagaccgtcttatcaagccagtgattggtcatggccatcaccatag</cdnaseq>|
 
AA = <aaseq>MLLRSIGQASHLTDDPPDEKTDATKIKAWKTADDRVMGFIFMSV                    EVPIRMSFRDHTTAKEMWDYLKQRYTQESGALRFSLLQNLHNLQQQDQSIEEFYNAFT                    RLSGQLEAQTPKGASGCAQCKAREKHDQENLVYQFVMRLSSQFESIRVQLLGRPTRPT                    MAEALADLIAEETRLCSLDTTPTPVVTHNVMAAPQRVGAPMGGIPEFSSIAKSDRICS                    HCKKVGHISDDCFYLHPEKLADYQARRAAVPRPRATASAPVFLDITAAGPSSTSAGGS                    ASSAVSCAPQSLVARPSYQASDWSWPSP</aaseq>|
 
DNA = <dnaseqindica>459..1373#atctatcactgtaagatggtatcagagctcatgggctgaaccctagccctcgatccccgttgtccgccggcgctccggcttgccggcggcggctccctatcgggcaaatcttcttcacgtcctcctcgtccggatcagcagcgggattcacagcaagtcagtgtgattcgtccgtcaagcgtgagtgcatcgctcattgcagccgctcgtcacgcggttgctccgctcagccgttgttgctgctcttccactactgctgccgctgtgtgctgctggtgctaattcaggagacaatacatcaagtcctgtaagcaagtctctgtccagtcaatttgtcaaattttcttctgctggtcttgatggcaacatccgacccctttcttggaggtggagctctgctctccacggacattaagctaaatggtcaaaattatcaagaatgagaactttcagctcgtatgcttttgaggtcgattggtcaagcatctcacctcacagatgatcctcctgatgagaaaacggatgcaactaaaattaaggcgtggaaaacagcagatgatcgtgttatgggattcatattcatgagtgtagaggtgcctattcggatgagtttcagggatcacactaccgctaaagagatgtgggactacctcaaacagaggtacactcaagaaagcggagctttgcgtttttccttgctgcagaatttgcacaacttacaacaacaagatcagtccattgaagaattttataatgcctttactcggttgtctggacagcttgaggcacagactccaaaaggtgcttcaggttgtgcacaatgcaaggcgagagagaagcatgatcaagaaaatctagtgtatcaatttgtcatgagactttcctctcaatttgagtccattcgagttcagttgcttggacgtcctacacgtcctactatggcggaggctcttgcagatctaatcgctgaggagacacgtctttgttccttggacactactcctactcctgtggttactcacaatgtcatggcagcacctcagcgtgttggagctcctatgggcgggatccctgaattcagttccatcgccaaaagtgatcgtatttgctctcattgcaagaaggttggacatatttccgatgattgcttctatcttcatccagagaagttggctgattatcaagctaggcgtgcagcggtcccccgtcctcgtgcgacggctagtgctcctgttttcttggatatcactgctgctggtccttctagtactagtgctggtggcagtgcctctagcgccgtctcatgtgctcctcagtcattggttgcaagaccgtcttatcaagccagtgattggtcatggccatcaccatagttggtccccaaggcctctaagtgtgaggtcatcttcgcctaccacttttgttgccatctcctacttgttgcttttgcttgctgtttggagaaaaaggttgttgctgctatagtatatatctgtccttcagttcagttcaagtcttctgttatccattaaatctatctaagtcaatttcatatcttc</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001053643.1 RefSeq:Os02g0552700]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 12:35, 8 May 2017

The rice Os06g0493100 was reported as OsZFP6 in 2014 [1] by researchers from China.

Annotated Information

Fig. 3. Subcellular localisation of the 35S::OsZFP6::GFP fusion protein..[1].

Function

  • OsZFP6 is a putatively useful gene for developing crops with increased alkali and H2O2 tolerance.
  • OsZFP6 plays an important role in abiotic stress responses.[1]

Phenotypic analysis

  • When OsZFP6 was transformed into yeast, the transgenic yeast showed significantly increased resistance to NaHCO3 compared to the control. * Moreover, Arabidopsis transgenic plants overexpressing 'OsZFP6 were more tolerant to both NaHCO3 and H2O2 treatments.

Expression

  • OsZFP6 expression was increased by abiotic stress, including salt (NaCl), alkali (NaHCO 3 ) and H2O2 treatment

Subcellular localization

  • The OsZFP6 protein contains 305 amino acids and a conserved zinc finger domain and is localised to the nucleus.

You can also add sub-section(s) at will.

Labs working on this gene

  • Northeast Institute of Geography and Agroecology, Key Laboratory of Soybean Molecular Design Breeding, Chinese Academy of Sciences, Harbin,Heilongjiang 150081, China
  • Key Laboratory of Biology and Genetic Resources of Rubber Tree, Ministry of Agriculture, State Key Laboratory Incubation Base for Cultivation and Physiology of Tropical Crops, Rubber Research Institute, CATAS, Danzhou, Hainan 571737, China
  • Alkali Soil Natural Environmental Science Center (ASNESC), Northeast Forestry University, Harbin, Heilongjiang 150040, China College of Life Sciences, Xinyang Normal University, China.

References

  1. 1.0 1.1 1.2 Zhang K, Qian Q, Huang Z, Wang Y, Li M, Hong L, Zeng D, Gu M, Chu C, Cheng Z. GOLD HULL AND INTERNODE2 encodes a primarily multifunctional cinnamyl-alcohol dehydrogenase in rice. Plant Physiol. 2006 Mar;140(3):972-83. Epub 2006 Jan 27. PubMed PMID: 16443696; PubMed Central PMCID: PMC1400561.

Structured Information