Difference between revisions of "Os09g0106700"

From RiceWiki
Jump to: navigation, search
 
(15 intermediate revisions by 4 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os09g0106700''''' was reported as '''''PutAKT1''''' in 2009 <ref name="ref1" /> by researchers from China.  
  
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
* ''PutAKT1'' is involved in mediating K+ uptake (i) both in low- and in high-affinity K+ uptake range, and (ii)in ''P. tenuiflora'' , even under saltstress condition.The notion that ''AKT1''-type channels are the main K+ uptake pathway into the plant root was based on their dominant expression in the roots and studies of ''AKT1''-disrupted mutants.
 +
*''PutAKT1'' not only increases tissue K+ accumulation, but also decreases Na+<ref name="ref1"/>.
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
*The AKT1 is preferentially expressed in peripheral root cell layers and root hairs.
 +
*Expression of ''PutAKT1'' increased the K+ content under normal K+ -starvation,and NaCl-stress conditions.
 +
*The expression of ''PutAKT1'' was induced by K+-starvation stress in the roots and was not downregulated by the presence of excess Na+.Over-expressing ''PutAKT1'' showed enhanced salt tolerance compared to wild-type plants as shown by their shoot phenotype and dry weight.
 +
* Expression of ''PutAKT1'' also showed a decrease in Na+ accumulation both in the shoot and in the root.
 +
====Expression in experiment====
 +
* Subjected to NaCl and K+-starvation stresses for 24 h, ''PutAKT1'' was predominantly expressed in the roots under all conditions tested (about two-fold higher than in the shoots). To gain further insight into ionic stress regulation of PutAKT1 expression in roots, ''PutAKT1'' expression was monitored over a 24-h period.
 +
* In rice, the expression level of ''PutAKT1'' is down-regulated by excessive external NaCl. Under K+-starvation stress, ''PutAKT1'' was dramatically induced at 24 h of stress.
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
*''PutAKT1'' belongs to the ''AKT1''-subfamily in the Shaker K+ channel family. ''PutAKT1'' was localized in the plasma membrane and it was preferentially expressed in the roots.there are three ''AKT1''-type K+ channel genes in Arabidopsis and two in rice.Genomic Southern-hybridizations using DIGlabeled PutAKT1 were performed with probes from the coding region of the PutAKT1. The result revealed a number of PutAKT1 hybridizing bands, suggesting that ''PutAKT''1 belongs to a small gene family.
 
 
You can also add sub-section(s) at will.
 
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* Asian Natural Environmental Science Center (ANESC),The University of Tokyo, 1-1-1 Midori-Cho, Nishitokyo,Tokyo 188-0002, Japan
 +
* Department of Agronomy and Horticulture,Bogor Agricultural University (IPB), Jl. Meranti, Kampus IPB, Darmaga Bogor 16680, Indonesia S. Liu
 +
* Alkali Soil Natural Environmental Science Center (ASNESC), Northeast Forestry University, Harbin 150040, China
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Ardie SW, Liu S, Takano T. Expression of the AKT1-type K(+) channel gene from
 +
Puccinellia tenuiflora, PutAKT1, enhances salt tolerance in Arabidopsis. Plant
 +
Cell Rep. 2010 Aug;29(8):865-74. doi: 10.1007/s00299-010-0872-2. PubMed PMID:
 +
20532513.
 +
</ref>
 +
</references>
 +
 
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os09g0106700|
 
Description = Similar to Myb proto-oncogene protein (C-myb)|
 
Version = NM_001069097.1 GI:115477933 GeneID:4346379|
 
Length = 1586 bp|
 
Definition = Oryza sativa Japonica Group Os09g0106700, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 9|Chromosome 9]]|
 
AP = Chromosome 9:603500..605085|
 
CDS = 604001..604960|
 
GCID = <gbrowseImage1>
 
name=NC_008402:603500..605085
 
source=RiceChromosome09
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008402:603500..605085
 
source=RiceChromosome09
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atgatggcgtcttgtcggagaggagggggaggggatgtggataggataaaggggccgtggagtccggaggaggacgaggcgctgcagcggctggtggggcggcacggggcgcgcaactggtcgctgataagcaagtccatcccggggaggtcggggaagtcgtgccggctgcggtggtgcaaccagctgtcgccgcaggtggagcaccggcccttcactcccgaggaggacgacaccatcctccgcgcccacgcccgcttcggcaacaagtgggccaccatcgccaggctcctcgccggccgcaccgacaacgccatcaagaaccactggaactccaccctcaagcgcaagcaccactcttctctcctcgccgacgacctccgccctctcaagcggacaaccagcgacggccacccgacgctctcctccgccgccgcccccgggagcccctccggctccgacctcagcgactccagccaccatagcctcccctcccagatgccctcctcacccccacacctcctcctccctcagcacgtctaccgcccggtcgcgagggccggcggggtcgtcgtccctcctcctcctcccccgccgcctccggcgacctcgctctccctctctctctcccttcccggcctggatcacccacaccccgatccctccaccccgtcggagcctgcggtacagttgcagccgcctccaccgtctcagatgccgccaccaacaccatcttgtgtacgccaagagccgcctcagatgccgttccagctgcagcccccaccgccgccgcgcccatcggcgccgttcagcgcggagttcttggccatgatgcaggagatgatccggatcgaggtccggaattacatgtccggctccgccgccgtggatcctcggtcgtcgcccgacaacggcgtgcgcgccgccagccgcatcatgggcatggccaagatcgagtaa</cdnaseq>|
 
AA = <aaseq>MMASCRRGGGGDVDRIKGPWSPEEDEALQRLVGRHGARNWSLIS                    KSIPGRSGKSCRLRWCNQLSPQVEHRPFTPEEDDTILRAHARFGNKWATIARLLAGRT                    DNAIKNHWNSTLKRKHHSSLLADDLRPLKRTTSDGHPTLSSAAAPGSPSGSDLSDSSH                    HSLPSQMPSSPPHLLLPQHVYRPVARAGGVVVPPPPPPPPPATSLSLSLSLPGLDHPH                    PDPSTPSEPAVQLQPPPPSQMPPPTPSCVRQEPPQMPFQLQPPPPPRPSAPFSAEFLA                    MMQEMIRIEVRNYMSGSAAVDPRSSPDNGVRAASRIMGMAKIE</aaseq>|
 
DNA = <dnaseqindica>126..1085#ctgacttaatttagctccgcctccattcacgcattcacactagcatagcatataagatagcacttgtagagaggagatactagtacacatagagaagaggagaggagattgatcggtgagggaggatgatggcgtcttgtcggagaggagggggaggggatgtggataggataaaggggccgtggagtccggaggaggacgaggcgctgcagcggctggtggggcggcacggggcgcgcaactggtcgctgataagcaagtccatcccggggaggtcggggaagtcgtgccggctgcggtggtgcaaccagctgtcgccgcaggtggagcaccggcccttcactcccgaggaggacgacaccatcctccgcgcccacgcccgcttcggcaacaagtgggccaccatcgccaggctcctcgccggccgcaccgacaacgccatcaagaaccactggaactccaccctcaagcgcaagcaccactcttctctcctcgccgacgacctccgccctctcaagcggacaaccagcgacggccacccgacgctctcctccgccgccgcccccgggagcccctccggctccgacctcagcgactccagccaccatagcctcccctcccagatgccctcctcacccccacacctcctcctccctcagcacgtctaccgcccggtcgcgagggccggcggggtcgtcgtccctcctcctcctcccccgccgcctccggcgacctcgctctccctctctctctcccttcccggcctggatcacccacaccccgatccctccaccccgtcggagcctgcggtacagttgcagccgcctccaccgtctcagatgccgccaccaacaccatcttgtgtacgccaagagccgcctcagatgccgttccagctgcagcccccaccgccgccgcgcccatcggcgccgttcagcgcggagttcttggccatgatgcaggagatgatccggatcgaggtccggaattacatgtccggctccgccgccgtggatcctcggtcgtcgcccgacaacggcgtgcgcgccgccagccgcatcatgggcatggccaagatcgagtaatcaaccagccgcagcagcatacggaatgatcgagtaatcaagctcagattgatgcactgcaagcaagaaagcagagcaagaagcagaggcgccggcgcggcaagtgaagagacgacgaccatcaacgtttggatcctccttttctattctgctatagtcttcttcttccccaataattccttgtctagttttaatttttttttctcttcaatttttactcctccaatccaagttgaagttgtcactagtagagttctccagagagagaggagatgaagcaacaacaaggagctgtgtctgcctgtctggaggaactaataccaaaccaaaataagcagagtgtgtgctgctgtgccacaatcagcaccaccaccgtggcaccacccactagcttagcttagctagctagttcaaagttctttttgtatatacttataagaggaaaaagaaaaaagagagctgatcagtgaaaattcagaatgcatcagtgaagagaattgc</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001069097.1 RefSeq:Os09g0106700]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 12:54, 8 May 2017

The rice Os09g0106700 was reported as PutAKT1 in 2009 [1] by researchers from China.

Annotated Information

Function

  • PutAKT1 is involved in mediating K+ uptake (i) both in low- and in high-affinity K+ uptake range, and (ii)in P. tenuiflora , even under saltstress condition.The notion that AKT1-type channels are the main K+ uptake pathway into the plant root was based on their dominant expression in the roots and studies of AKT1-disrupted mutants.
  • PutAKT1 not only increases tissue K+ accumulation, but also decreases Na+[1].

Expression

  • The AKT1 is preferentially expressed in peripheral root cell layers and root hairs.
  • Expression of PutAKT1 increased the K+ content under normal K+ -starvation,and NaCl-stress conditions.
  • The expression of PutAKT1 was induced by K+-starvation stress in the roots and was not downregulated by the presence of excess Na+.Over-expressing PutAKT1 showed enhanced salt tolerance compared to wild-type plants as shown by their shoot phenotype and dry weight.
  • Expression of PutAKT1 also showed a decrease in Na+ accumulation both in the shoot and in the root.

Expression in experiment

  • Subjected to NaCl and K+-starvation stresses for 24 h, PutAKT1 was predominantly expressed in the roots under all conditions tested (about two-fold higher than in the shoots). To gain further insight into ionic stress regulation of PutAKT1 expression in roots, PutAKT1 expression was monitored over a 24-h period.
  • In rice, the expression level of PutAKT1 is down-regulated by excessive external NaCl. Under K+-starvation stress, PutAKT1 was dramatically induced at 24 h of stress.

Evolution

  • PutAKT1 belongs to the AKT1-subfamily in the Shaker K+ channel family. PutAKT1 was localized in the plasma membrane and it was preferentially expressed in the roots.there are three AKT1-type K+ channel genes in Arabidopsis and two in rice.Genomic Southern-hybridizations using DIGlabeled PutAKT1 were performed with probes from the coding region of the PutAKT1. The result revealed a number of PutAKT1 hybridizing bands, suggesting that PutAKT1 belongs to a small gene family.

Labs working on this gene

  • Asian Natural Environmental Science Center (ANESC),The University of Tokyo, 1-1-1 Midori-Cho, Nishitokyo,Tokyo 188-0002, Japan
  • Department of Agronomy and Horticulture,Bogor Agricultural University (IPB), Jl. Meranti, Kampus IPB, Darmaga Bogor 16680, Indonesia S. Liu
  • Alkali Soil Natural Environmental Science Center (ASNESC), Northeast Forestry University, Harbin 150040, China

References

  1. 1.0 1.1 Ardie SW, Liu S, Takano T. Expression of the AKT1-type K(+) channel gene from Puccinellia tenuiflora, PutAKT1, enhances salt tolerance in Arabidopsis. Plant Cell Rep. 2010 Aug;29(8):865-74. doi: 10.1007/s00299-010-0872-2. PubMed PMID: 20532513.


Structured Information