Difference between revisions of "Os07g0529600"

From RiceWiki
Jump to: navigation, search
(Function)
 
(10 intermediate revisions by 3 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os07g0529600''''' was reported as '''''OsDR8''''' in 2006 by researchers from China.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
[[File:1.png|right|thumb|227px|]]
 +
===Gene Symbol===
 +
*'''''Os07g0529600''''' '''''<=>''''' '''''FOXRED1, OsDR8, OsXNP'''''
 +
 
===Function===
 
===Function===
 
+
* Silencing of OsDR8 using an RNA interference approach resulted in phenotypic alteration of the plants.  
The function of OsDR8, a rice disease resistance-responsive gene, was studied. Silencing of OsDR8 using an RNA interference approach resulted in phenotypic alteration of the plants. The transgenic plants with repressed expression of OsDR8 showed reduced resistance or susceptibility to Xanthomonas oryzae pv.oryzae and Magnaporthe grisea causing bacterial blight and blast, which are two of the most devastating diseases in rice worldwide, respectively. The putative product of OsDR8 was highly homologous to an enzyme involved in the biosynthesis of the thiazole precursor of thiamine. Transgenic plants showing repressed expression of OsDR8 and reduced resistance had significantly lower levels of thiamine than the control plants. Exogenous application of thiamine could complement the compromised defense of the OsDR8-silenced plants. The expression level of several defense-responsive genes including the earlier functional genes of defense transduction pathway, OsPOX and OsPAL, and the downstream genes of the pathway, OsPR1a, OsPR1b, OsPR4, OsPR5 and OsPR10, was also decreased in the OsDR8-silenced
+
* The transgenic plants with repressed expression of OsDR8 showed reduced resistance or susceptibility to Xanthomonas oryzae pv. oryzae and Magnaporthe grisea causing bacterial blight and blast, which are two of the most devastating diseases in rice worldwide, respectively.
plants. These results suggest that the impact of OsDR8 on disease resistance in rice may be through the regulation of expression of other defense-responsive genes and the site of OsDR8 function is on the upstream of the signal transduction pathway. In addition, the accumulation of thiamine may be essential for bacterial blight resistance and blast resistance.
 
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
* The impact of OsDR8 on disease resistance in rice may be through the regulation of expression of other defense-responsive genes and the site of OsDR8 function is on the upstream of the signal transduction pathway. In addition, the accumulation of thiamine may be essential for bacterial blight resistance and blast resistance.
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
* The putative product of OsDR8 was highly homologous to an enzyme involved in the biosynthesis of the thiazole precursor of thiamine.
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
National Key Laboratory of Crop Genetic Improvement, National Center of Plant Gene Research
  
 
==References==
 
==References==
Please input cited references here.
+
Dual function of rice OsDR8 gene in disease resistance and thiamine accumulation, Gongnan  Wang, Xinhua Ding, Meng Yuan, Deyun Qiu, Xianghua Li, Caiguo Xu and Shiping Wang,  Plant Molecular Biology (2006) 60:437-449.
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os07g0529600|
 
Description = Similar to Thiazole biosynthetic enzyme 1-1, chloroplast precursor|
 
Version = NM_001066376.1 GI:115472484 GeneID:4343443|
 
Length = 1489 bp|
 
Definition = Oryza sativa Japonica Group Os07g0529600, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 7|Chromosome 7]]|
 
AP = Chromosome 7:21384739..21386227|
 
CDS = 21384795..21385688,21385767..21385940|
 
GCID = <gbrowseImage1>
 
name=NC_008400:21384739..21386227
 
source=RiceChromosome07
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008400:21384739..21386227
 
source=RiceChromosome07
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggcagccatggccaccaccgcgtccagcctcctcaagacctccttcgctggcgcgcgcctccccgccgccgcccgcaaccccaccgtctccgtcgcgccgcgcaccggcggcgccatctgcaactccatctcgtcgtcgtcgtccactcccccctacgacctcaacgccatcaggttcagccccatcaaggagtccatcgtgtctcgcgagatgacccggcggtacatgaccgacatgatcacctacgccgacaccgacgtcgtcgtcgtcggcgccggctccgcggggctctcctgcgcgtacgagctctccaaggacccctccgtcagcgtcgccgtcatcgagcagtcggtgtcccccggcggcggcgcgtggctcggcgggcagctgttctccgccatggtggtgcgcaagccggcgcacctgttcctcgacgagctcggcgtcgcgtacgacgagcaggaggactacgtcgtcatcaagcacgccgcgctcttcacctccaccgtcatgagccgcctcctggcgcgccccaacgtgaagctgttcaacgccgtcgccgtcgaggacctcatcgtcaaggagggccgcgtcggcggcgtggtcaccaactgggcgctggtgtcgatgaaccacgacacgcagtcgtgcatggaccccaacgtgatggagtccagggtggtggtgagctcctgcggccacgacgggccgttcggcgccacgggcgtcaagcggctgcaggacatcggcatgatcgacgccgtgcccggcatgcgcgccctcgacatgaacaccgccgaggacgagatcgtccgcctcacccgcgaggtcgtccccggcatgatcgtcaccggcatggaggtcgccgagatcgacggcgccccgagaatgggcccgacgttcggagccatgatgatctccggccagaaggcggcgcacctggcgctgaaggcgctcggccggccgaacgccatcgacggcacgatcaagaaggcggcggcggcggcggcgcacccggagctgatcctggcgtcgaaggacgacggcgagatcgtggacgcctga</cdnaseq>|
 
AA = <aaseq>MAAMATTASSLLKTSFAGARLPAAARNPTVSVAPRTGGAICNSI                    SSSSSTPPYDLNAIRFSPIKESIVSREMTRRYMTDMITYADTDVVVVGAGSAGLSCAY                    ELSKDPSVSVAVIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGVAYDEQEDYVV                    IKHAALFTSTVMSRLLARPNVKLFNAVAVEDLIVKEGRVGGVVTNWALVSMNHDTQSC                    MDPNVMESRVVVSSCGHDGPFGATGVKRLQDIGMIDAVPGMRALDMNTAEDEIVRLTR                    EVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNAIDGTIKKAA                    AAAAHPELILASKDDGEIVDA</aaseq>|
 
DNA = <dnaseqindica>57..950#1029..1202#actcacacacactctcctcatcccagagcaagaagctcagctcctcctcctctcgcatggcagccatggccaccaccgcgtccagcctcctcaagacctccttcgctggcgcgcgcctccccgccgccgcccgcaaccccaccgtctccgtcgcgccgcgcaccggcggcgccatctgcaactccatctcgtcgtcgtcgtccactcccccctacgacctcaacgccatcaggttcagccccatcaaggagtccatcgtgtctcgcgagatgacccggcggtacatgaccgacatgatcacctacgccgacaccgacgtcgtcgtcgtcggcgccggctccgcggggctctcctgcgcgtacgagctctccaaggacccctccgtcagcgtcgccgtcatcgagcagtcggtgtcccccggcggcggcgcgtggctcggcgggcagctgttctccgccatggtggtgcgcaagccggcgcacctgttcctcgacgagctcggcgtcgcgtacgacgagcaggaggactacgtcgtcatcaagcacgccgcgctcttcacctccaccgtcatgagccgcctcctggcgcgccccaacgtgaagctgttcaacgccgtcgccgtcgaggacctcatcgtcaaggagggccgcgtcggcggcgtggtcaccaactgggcgctggtgtcgatgaaccacgacacgcagtcgtgcatggaccccaacgtgatggagtccagggtggtggtgagctcctgcggccacgacgggccgttcggcgccacgggcgtcaagcggctgcaggacatcggcatgatcgacgccgtgcccggcatgcgcgccctcgacatgaacaccgccgaggacgagatcgtccgcctcacccgcgaggtcgtccccggcatgatcgtcaccggcatggaggtcgccgagatcgacggcgccccgagaatggtacgcaccaaaaaaacatcaaactcttcaccataatctctcccccgttcttggatttgaacaaattcgttgttgcagggcccgacgttcggagccatgatgatctccggccagaaggcggcgcacctggcgctgaaggcgctcggccggccgaacgccatcgacggcacgatcaagaaggcggcggcggcggcggcgcacccggagctgatcctggcgtcgaaggacgacggcgagatcgtggacgcctgagcgaatagaacagggtaaaaaaaaatccgcaagacgtggtggtgacacggaggagttggggacgagaagaagatgtggactttcccctgtgtttttttttcgggatttgcattgatccccttgtttgttttagctctggatgttgattagcgtcttgttcatagcacttccactgccaccgtgtgtgtgtgctctgcttgcctgatgagggcaagaaaacttccatggatccgtctctctgggaggaatgaataaaaaggatgaggaaataaaaatgattcagtgcc</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001066376.1 RefSeq:Os07g0529600]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 13:00, 8 May 2017

The rice Os07g0529600 was reported as OsDR8 in 2006 by researchers from China.

Annotated Information

1.png

Gene Symbol

  • Os07g0529600 <=> FOXRED1, OsDR8, OsXNP

Function

  • Silencing of OsDR8 using an RNA interference approach resulted in phenotypic alteration of the plants.
  • The transgenic plants with repressed expression of OsDR8 showed reduced resistance or susceptibility to Xanthomonas oryzae pv. oryzae and Magnaporthe grisea causing bacterial blight and blast, which are two of the most devastating diseases in rice worldwide, respectively.

Expression

  • The impact of OsDR8 on disease resistance in rice may be through the regulation of expression of other defense-responsive genes and the site of OsDR8 function is on the upstream of the signal transduction pathway. In addition, the accumulation of thiamine may be essential for bacterial blight resistance and blast resistance.

Evolution

  • The putative product of OsDR8 was highly homologous to an enzyme involved in the biosynthesis of the thiazole precursor of thiamine.

You can also add sub-section(s) at will.

Labs working on this gene

National Key Laboratory of Crop Genetic Improvement, National Center of Plant Gene Research

References

Dual function of rice OsDR8 gene in disease resistance and thiamine accumulation, Gongnan Wang, Xinhua Ding, Meng Yuan, Deyun Qiu, Xianghua Li, Caiguo Xu and Shiping Wang, Plant Molecular Biology (2006) 60:437-449.

Structured Information