Difference between revisions of "Os06g0700700"

From RiceWiki
Jump to: navigation, search
(Mutation)
 
(17 intermediate revisions by one other user not shown)
Line 1: Line 1:
OsHMA2 is a transporter of Zn and Cd in rice and involved in the root-to-shoot translocation of Zn and Cd.  
+
OsHMA2 is a transporter of Zn and Cd in rice and is involved in the root-to-shoot translocation of Zn and Cd.  
  
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
 +
[[File:1.png|right|thumb|150px|'' Phylogenic tree of HMAs from rice and Arabidopsis.(from reference <ref name="ref1" />).'']]
 
[[File:subcellular localization of OsHMA2.png |right|thumb|150px|''subcellular localization of OsHMA2 (from reference <ref name="ref3" />).'']]
 
[[File:subcellular localization of OsHMA2.png |right|thumb|150px|''subcellular localization of OsHMA2 (from reference <ref name="ref3" />).'']]
The P1B-type heavy metal ATPases(HMA) are transporters which play an important role in the translocation or detoxification of Zn or Cd in plants. These transporters are divided into two subgroups based on their metal-substrate specificity: a copper (Cu)/silver (Ag) group and a zinc (Zn)/cobalt (Co)/cadmium (Cd)/lead (Pb) group. Rice(''Oryza sativa'' L.) has nine HAM genes. OsHMA2 belongs to the Zn/Co/Cd/Pb subgroup. ''OsHMA2'' is a gene which is localized in the plasma membrane and trasport Zn and Cd out of the cell. <ref name="ref1" /> ''OsHMA2'' plays an important role in the root-to-shoot translocation of Zn and Cd, and participate in Zn and Cd transport to developing seeds in rice. In rice, ''OsHMA2'' is the only gene which is responsible for the translocation of Zn, unlike Arabidopsis, in which two genes have redundant fuctions. OsHMA2 is also the transporter of Cd in rice and to date, the OsHMA2 is the only one gene which translocate both Zn and Cd in rice. <ref name="ref2" /> OsHMA2 also plays a role in Zn transport during flowering and seed maturing. <ref name="ref1" />
+
The P1B-type heavy metal ATPases(HMA) are transporters which play an important role in the translocation or detoxification of Zn or Cd in plants. These transporters are divided into two subgroups based on their metal-substrate specificity: a copper (Cu)/silver (Ag) group and a zinc (Zn)/cobalt (Co)/cadmium (Cd)/lead (Pb) group. Rice(''Oryza sativa'' L.) has nine HAM genes. OsHMA2 belongs to the Zn/Co/Cd/Pb subgroup. ''OsHMA2'' is a gene which is localized in the plasma membrane and trasport Zn and Cd out of the cell. <ref name="ref1" /> ''OsHMA2'' plays an important role in the root-to-shoot translocation of Zn and Cd, and participate in Zn and Cd transport to developing seeds in rice. In rice, ''OsHMA2'' is the only gene which is responsible for the translocation of Zn, unlike Arabidopsis, in which two genes have redundant fuctions. OsHMA2 is also the transporter of Cd in rice and to date, the OsHMA2 is the only one gene which translocate both Zn and Cd in rice. <ref name="ref2" /> OsHMA2 also plays a role in Zn transport during flowering and seed maturing. <ref name="ref1" /> OsHMA2 in the nodes plays an important role in preferential distribution of Zn as well as Cd through the phloem to the developing tissues. <ref name="ref4"/>
  
 
===Expression===
 
===Expression===
Line 14: Line 15:
  
 
===Mutation===
 
===Mutation===
''OsHMA2'' is composed of nine exons and eight introns. Secondary structure prediction of membrane proteins, an online bioinformatics tool, predicted that the OsHMA2 protein in the wild type has six transmembrane segments and a histidine-rich C-terminal domain. To investigate the function of ''OsHMA2'', three the retrotransposon ''Tos17'' insertion mutants were obtained. The ''Tos17'' insertion into intron 5 was designated ''oshma2-1''.In other two lines the insertions were in exon 9 at different positions. Only two transmembrane segments occur in oshma2-1 according to SOSUI predition. In ''oshma2-2'', most of the C-terminal region after the last transmembrane segment is absent, and in ''oshma2-3'', only part of the histidine-rich C-terminal region is absent. <ref name="ref2"/ >
+
[[File:The concentration of Cd and Zn in shoots,roots and the whole plant.png|right|thumb|150px|''The concentration of Cd and Zn in shoots,roots and the whole plant(from reference <ref name="ref2" />).'']]
 +
''OsHMA2'' is composed of nine exons and eight introns. Secondary structure prediction of membrane proteins, an online bioinformatics tool, predicted that the OsHMA2 protein in the wild type has six transmembrane segments and a histidine-rich C-terminal domain. To investigate the function of ''OsHMA2'', three the retrotransposon ''Tos17'' insertion mutants were obtained. The ''Tos17'' insertion into intron 5 was designated ''oshma2-1''.In other two lines the insertions were in exon 9 at different positions. Only two transmembrane segments occur in oshma2-1 according to SOSUI predition. In ''oshma2-2'', most of the C-terminal region after the last transmembrane segment is absent, and in ''oshma2-3'', only part of the histidine-rich C-terminal region is absent. <ref name="ref2"/>  
  
 +
When grow wild type and three ''oshma2'' mutants with 4.5nM Cd, oshma2 mutants had a significantly lower translocation ratio of Cd and Zn than the wild type. The concentrations of Cd and Zn in shoots of the ''oshma2'' mutants were very low. And the concentration of Cd in the roots of ''oshma2'' mutants were not significantly different from those of wild type, while the concentration of Zn in roots of ''oshma2'' mutants higher than the wild type. No significant difference were observed between oshma2 mutants and wild type in the concentration of accumulated Cd and Zn in whole plants.  <ref name="ref2"/>
  
When grow wild type and three ''oshma2'' mutants with 4.5nM Cd, oshma2 mutants had a significantly lower translocation ratio of Cd and Zn than the wild type. The concentrations of Cd and Zn in shoots of the ''oshma2'' mutants were very low. And the concentration of Cd in the roots of oshma2 mutants were not significantly different from those of wild type, while the concentration of Zn in roots of oshma2 mutants higher than the wild type.<ref name="ref2"/ >
+
When OsHMA2-suppressed rice was grown in a Cd-contaminated paddy field, both the Zn and Cd concentrations in the grains decreased.31 OsHMA2-overexpressing rice
 +
also contained less Zn and Cd in the grains compared with the wild type. <ref name="ref1"/>
  
 
===Evolution===
 
===Evolution===
Line 25: Line 29:
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
 
 +
*Graduate School of Agricultural and Life Sciences; The University of Tokyo; Tokyo, Japan
 +
*Graduate School of Science; Tohoku University; Sendai, Miyagi, Japan
 +
*Institute for Bioresources and Biotechnology; Ishikawa Prefectural University; Ishikawa, Japan
 +
*Department of Biological Production, Faculty of Bioresource Sciences, Akita Prefectural University, Kaidoubata-Nishi
 +
*Akita Agricultural Experiment Station, Genpachizawa 34-1, Aikawa, Yuwa, Akita, 010-1231 Japan
 +
*Research Institute for Bioresources & Biotechnology, Ishikawa Prefectural University, 1-308 Suematsu, Nonoichi-shi, Ishikawa, 921-8836, Japan
  
 
==References==
 
==References==
Line 32: Line 42:
 
<ref name="ref2"> Namiko Satoh-Nagasawa, Mikako Mori, Nobushige Nakazawa, Tomohiko Kawamot3, Yasuo Nagato, Kenji Sakurai, Hidekazu Takahashi, Akio Watanabe and Hiromori Akagi.(2012) Mutations in Rice (Oryza sativa) Heavy Metal ATPase2 (OsHMA2) Restrict the Translocation of Zinc and Cadmium. Plant Cell Physiol 53(1): 213–224. </ref>
 
<ref name="ref2"> Namiko Satoh-Nagasawa, Mikako Mori, Nobushige Nakazawa, Tomohiko Kawamot3, Yasuo Nagato, Kenji Sakurai, Hidekazu Takahashi, Akio Watanabe and Hiromori Akagi.(2012) Mutations in Rice (Oryza sativa) Heavy Metal ATPase2 (OsHMA2) Restrict the Translocation of Zinc and Cadmium. Plant Cell Physiol 53(1): 213–224. </ref>
 
<ref name="ref3"> Ryuichi Takahashi, Yasuhiro Ishimaru, Hugo Shimo, Yuko Ogo, Takeshi Ssnoura, Naoko K. Nishizawa and Hiromi Nakaishi.(2012) The OsHMA2 transporter is involved in root-to-shoot translocation of Zn and Cd in rice. Plant, Cell and Environment 35:1948–1957. </ref>
 
<ref name="ref3"> Ryuichi Takahashi, Yasuhiro Ishimaru, Hugo Shimo, Yuko Ogo, Takeshi Ssnoura, Naoko K. Nishizawa and Hiromi Nakaishi.(2012) The OsHMA2 transporter is involved in root-to-shoot translocation of Zn and Cd in rice. Plant, Cell and Environment 35:1948–1957. </ref>
 +
<ref name="ref4"> Naoki Yamaji, Jixing Xia, Namiki Mitani-Ueno, Kengo Yokosho, and Jian Feng Ma.(2013) Preferential Delivery of Zinc to Developing Tissues in Rice Is Mediated by P-Type Heavy Metal ATPase OsHMA2. Plant Physiology 162:927–939. </ref>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os06g0700700|
 
Description = Similar to P1B-type heavy metal transporting ATPase|
 
Version = NM_001065015.1 GI:115469761 GeneID:4341965|
 
Length = 2957 bp|
 
Definition = Oryza sativa Japonica Group Os06g0700700, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|
 
AP = Chromosome 6:30354951..30357907|
 
CDS = 30355990..30356270,30357298..30357487|
 
GCID = <gbrowseImage1>
 
name=NC_008399:30354951..30357907
 
source=RiceChromosome06
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008399:30354951..30357907
 
source=RiceChromosome06
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggcggcggagggagggaggtgtcagaagagctacttcgacgtgctggggatttgctgcccgtcggaggttcccctcgtcgagaagcttctgcagccgctggagggcgtccagaaggtcaccgtgatcgttccctccaggacggtcatcgtcgtccacgacgtcgacgccatctcccaatcccaaatcgtcaaggcgctgaatcaggcaaggttggaggcgtcggttcgggcttatgggaacggcagtgagaagatcaccaacaaatggccgagcccgtatgttctcctctgcggacttcttctggtcgtgtcgctgttcgagcatttctggcacccgctcaagtggttcgcgctggtggctgcggccgccggcttgccgccgatcgtgctgaggagcattgcggccatccggagactcaccctggatgtcaacatactcatgctgattgctggtaagaacagcctataa</cdnaseq>|
 
AA = <aaseq>MAAEGGRCQKSYFDVLGICCPSEVPLVEKLLQPLEGVQKVTVIV                    PSRTVIVVHDVDAISQSQIVKALNQARLEASVRAYGNGSEKITNKWPSPYVLLCGLLL                    VVSLFEHFWHPLKWFALVAAAAGLPPIVLRSIAAIRRLTLDVNILMLIAGKNSL</aaseq>|
 
DNA = <dnaseqindica>1638..1918#421..610#ctatccccgattcgcacagccaatctcttcttgcttcctcctcctcctcctccagccgccgccgccgacgacgattcttggtagagagattcttgcgttgttttacctgcgtcttgttcttcttgggagttgggtggatcgattgatcgaggttttggaggttggaagaagtgtgtgttgtggtggggggtaagtgagatggagaactgaattcactgaactcattttctttccttttttttttggtctgacaagaagtaaaaattcctgaacctgaaaccaaccaaaggacaggttggtcgacacgccaagattgcttttgctgctgtgtccttctcactcttgttcttgttcttgcttcttcaggtttgtagagagagagagggcaaaggcacgcaaagagggagagagtgaggagagatggcggcggagggagggaggtgtcagaagagctacttcgacgtgctggggatttgctgcccgtcggaggttcccctcgtcgagaagcttctgcagccgctggagggcgtccagaaggtcaccgtgatcgttccctccaggacggtcatcgtcgtccacgacgtcgacgccatctcccaatcccaaatcggtgagagccccccttttttcttttttgctttccgagtggattgattcatctccctttcgtgattaagatcgatctctccttccatcttgacttgtcacttatcattgtcctgtgatcaatgaatgataccaatcatgcaaccggtgactgagccatcttgtgggatttgtggagtttttgggtgggtcaagaagtcacacgagactagaccagaccagagtctcagtaatttgaagaaaacgatcttttttattttctttgtcatggctgcttgtttgttcattggattttcgatgattttatttctgttcttgctagtttaatcagaatcttactttaattatcgcaagaaaaattggatcttaacatatatatagcgtgttgagcgatggaaagcatcacgcaaagttgcttgcgtttctcattctgttcttgctgttcatgagttgttccagtatctgtattttttttttgtttgtttgtttgtttgttcacaataaatttcatttctaatcgttgcttgattcaataactagccagccaagcaaaggtggtgtcatgtgttcgtttgttttcatggctcgaggctggggaccacttaccatgtcagaaaataagtgcaaaatttcatactccaactctactaaaatgggatgtttgctagcgacaagtgaaccgtcttggcagtggtcgctattgttcatgacgcagggagcaattactgatacgattggacatatctcttgactcgttaattctgacctcagcacccccgaaatcctgctaattttgcagtttctgtcacgagaattaaggaacttgattactgtacaatactgtcacactcaatgaaaccgccagtttttcatctttggttcttgaaacagtcattacataattttagataaatgttactgtccttgaggaggtataccaattatgacagatggacagtaaaatcaatcacgattttagcatgacaaaactcttgaaagcttgatttgattttgatatttgctgttttcagtcaaggcgctgaatcaggcaaggttggaggcgtcggttcgggcttatgggaacggcagtgagaagatcaccaacaaatggccgagcccgtatgttctcctctgcggacttcttctggtcgtgtcgctgttcgagcatttctggcacccgctcaagtggttcgcgctggtggctgcggccgccggcttgccgccgatcgtgctgaggagcattgcggccatccggagactcaccctggatgtcaacatactcatgctgattgctggtaagaacagcctataattcacctgtgacattaatgatgtttcctgttattggtaccttgaaaaaaaaagaagctcccttttgttggaggatggccctgaccatcacctccgacgatcgaagaccctttgatctttaggagataactgaattataaaattttaaataggcttccttcatctggtggcctaatgcatgcattttggcttgtaccaaaacctactttctctctttaatgaaatgaaaagcagaggtcccaccatactttttgaaaagaaatgaacgtttaaatagtatcgaatggtagcaaacacatctgccattaaggatatcctccaattgaatagtctcatttgaaataagaaaacaaattattgacacagcttagtagtagagcattgagttttaacgttgatgccatgggtttgaagcttttttttctgtattaaaagggcaacagtatacttgttcctttttttaccatagtattctcttgtgtgtagaagacacaaatacaacaccactttgggtaaatattcaactacggattgaagttgtgggtattattgatacctgttctaccagtgtgacaatgggttgtgaaaaaaaaagagacaaaagcaagtttcttcacgaggaccaatatggtgggtgattagtgggagagcagaagcagaaatccatctctcaaaagtttatgtctcacttgcataaacttttgctttcttttcttttctagagggtccctcactttccatcacatcaaaaggatatgttgctgtgatgctaatatacgtgctagatgaacaattctgcttcttttcctccatgtggcgatgtcacctcagatagggcatcagattccttttagaacaagcaacatatttcttatcaagaagctacacatatttcgaataattctttctagactaatatcgtggcattgagatagctctattgtgatatgcatatgggaatatgggatacatgaaagaatcatcaaaagaaacaagaaataccttgtttcaaaaagaaaaaaagatttggaagatttggt</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001065015.1 RefSeq:Os06g0700700]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 13:12, 8 May 2017

OsHMA2 is a transporter of Zn and Cd in rice and is involved in the root-to-shoot translocation of Zn and Cd.

Annotated Information

Function

Phylogenic tree of HMAs from rice and Arabidopsis.(from reference [1]).
subcellular localization of OsHMA2 (from reference [2]).

The P1B-type heavy metal ATPases(HMA) are transporters which play an important role in the translocation or detoxification of Zn or Cd in plants. These transporters are divided into two subgroups based on their metal-substrate specificity: a copper (Cu)/silver (Ag) group and a zinc (Zn)/cobalt (Co)/cadmium (Cd)/lead (Pb) group. Rice(Oryza sativa L.) has nine HAM genes. OsHMA2 belongs to the Zn/Co/Cd/Pb subgroup. OsHMA2 is a gene which is localized in the plasma membrane and trasport Zn and Cd out of the cell. [1] OsHMA2 plays an important role in the root-to-shoot translocation of Zn and Cd, and participate in Zn and Cd transport to developing seeds in rice. In rice, OsHMA2 is the only gene which is responsible for the translocation of Zn, unlike Arabidopsis, in which two genes have redundant fuctions. OsHMA2 is also the transporter of Cd in rice and to date, the OsHMA2 is the only one gene which translocate both Zn and Cd in rice. [3] OsHMA2 also plays a role in Zn transport during flowering and seed maturing. [1] OsHMA2 in the nodes plays an important role in preferential distribution of Zn as well as Cd through the phloem to the developing tissues. [4]

Expression

The expression of OsHMA2(from reference [2]).

Total RNA was extracted from rice using the RNeasy Plant Mini Kit. The RNA was reverse transcribed using an oligo dT primer and the ReverTra Ace reverse transcriptase. Amplification reactions were carried out with the HMA2-F1 primer (5′-GCAGATCAAGTCACCCCATGG-3′) and the HMA2-R1 primer (5′-GCCATCACCAAC CATCAGCGT-3′). As an internal standard, the a-tubulin gene was used as described previously. Transcript abundance was normalized by a-tubulin expression level, and the results represent average number of copies of OsHMA2 transcripts in 1 mg of total RNA in three reactions.[2]

The expression of OsHMA2 was observed mainly in the roots. Using LM, OsHMA2 transcripts were detected mainly in vascular bundles. Expression of OsHMA2 in the roots was unchanged in the presence of Cd, whereas expression in the shoots increased in the presence of 1 mm Cd. Under Zn deficiency, the expression of OsHMA2 decreased in the roots, whereas it remained unchanged in shoots. In contrast, the expression of OsHMA2 increased in roots under Fe deficiency, whereas it decreased in shoots. Expression of OsHMA2 was unchanged in both roots and shoots under Mn deficiency.[2]

Mutation

The concentration of Cd and Zn in shoots,roots and the whole plant(from reference [3]).

OsHMA2 is composed of nine exons and eight introns. Secondary structure prediction of membrane proteins, an online bioinformatics tool, predicted that the OsHMA2 protein in the wild type has six transmembrane segments and a histidine-rich C-terminal domain. To investigate the function of OsHMA2, three the retrotransposon Tos17 insertion mutants were obtained. The Tos17 insertion into intron 5 was designated oshma2-1.In other two lines the insertions were in exon 9 at different positions. Only two transmembrane segments occur in oshma2-1 according to SOSUI predition. In oshma2-2, most of the C-terminal region after the last transmembrane segment is absent, and in oshma2-3, only part of the histidine-rich C-terminal region is absent. [3]

When grow wild type and three oshma2 mutants with 4.5nM Cd, oshma2 mutants had a significantly lower translocation ratio of Cd and Zn than the wild type. The concentrations of Cd and Zn in shoots of the oshma2 mutants were very low. And the concentration of Cd in the roots of oshma2 mutants were not significantly different from those of wild type, while the concentration of Zn in roots of oshma2 mutants higher than the wild type. No significant difference were observed between oshma2 mutants and wild type in the concentration of accumulated Cd and Zn in whole plants. [3]

When OsHMA2-suppressed rice was grown in a Cd-contaminated paddy field, both the Zn and Cd concentrations in the grains decreased.31 OsHMA2-overexpressing rice also contained less Zn and Cd in the grains compared with the wild type. [1]

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

  • Graduate School of Agricultural and Life Sciences; The University of Tokyo; Tokyo, Japan
  • Graduate School of Science; Tohoku University; Sendai, Miyagi, Japan
  • Institute for Bioresources and Biotechnology; Ishikawa Prefectural University; Ishikawa, Japan
  • Department of Biological Production, Faculty of Bioresource Sciences, Akita Prefectural University, Kaidoubata-Nishi
  • Akita Agricultural Experiment Station, Genpachizawa 34-1, Aikawa, Yuwa, Akita, 010-1231 Japan
  • Research Institute for Bioresources & Biotechnology, Ishikawa Prefectural University, 1-308 Suematsu, Nonoichi-shi, Ishikawa, 921-8836, Japan

References

<references> [1] [3] [2] [4]

Structured Information

  1. 1.0 1.1 1.2 1.3 1.4 Ryuichi Takahashi, Khurram Bashir, Yasuhiro Ishimaru, Naoko K. Nishizawa and Hiromi Nakanishi.(2012) The role of heavy-metal ATPases, HMAs, in zinc and cadmium transport in rice. Plant Signaling & Behavior 7:12, 1605–1607.
  2. 2.0 2.1 2.2 2.3 2.4 Ryuichi Takahashi, Yasuhiro Ishimaru, Hugo Shimo, Yuko Ogo, Takeshi Ssnoura, Naoko K. Nishizawa and Hiromi Nakaishi.(2012) The OsHMA2 transporter is involved in root-to-shoot translocation of Zn and Cd in rice. Plant, Cell and Environment 35:1948–1957.
  3. 3.0 3.1 3.2 3.3 3.4 Namiko Satoh-Nagasawa, Mikako Mori, Nobushige Nakazawa, Tomohiko Kawamot3, Yasuo Nagato, Kenji Sakurai, Hidekazu Takahashi, Akio Watanabe and Hiromori Akagi.(2012) Mutations in Rice (Oryza sativa) Heavy Metal ATPase2 (OsHMA2) Restrict the Translocation of Zinc and Cadmium. Plant Cell Physiol 53(1): 213–224.
  4. 4.0 4.1 Naoki Yamaji, Jixing Xia, Namiki Mitani-Ueno, Kengo Yokosho, and Jian Feng Ma.(2013) Preferential Delivery of Zinc to Developing Tissues in Rice Is Mediated by P-Type Heavy Metal ATPase OsHMA2. Plant Physiology 162:927–939.