Difference between revisions of "Os09g0561600"

From RiceWiki
Jump to: navigation, search
(Evolution)
 
(21 intermediate revisions by 2 users not shown)
Line 4: Line 4:
 
===Function===
 
===Function===
  
OsDEES1,a rice WAK-RLK gene,plays a role in rice sexual reproduction by regulating female gametophyte development.OsDEES1 silencing by RNA interference caused a high rate of female sterility. Crossing experiments showed that female reproductive organs lacking OsDEES1 carried a functional defect.
+
OsDEES1,a rice WAK-RLK gene,plays a role in rice sexual reproduction by regulating female gametophyte development.OsDEES1 silencing by RNA interference caused a high rate of female sterility<ref name="ref1" />. Crossing experiments showed that female reproductive organs lacking OsDEES1 carried a functional defect<ref name="ref1" />.
 +
 
 
===The phenotype of OsDEES1 RNA interference plants===
 
===The phenotype of OsDEES1 RNA interference plants===
 
the knockdown of OsDEES1 expression did not affect megasporogenesis
 
the knockdown of OsDEES1 expression did not affect megasporogenesis
Line 10: Line 11:
 
rice exhibited a near-normal morphology in terms of growth but a high rate of sterility (Fig. 1, A and B).Of 44 RNAi transgenic plants obtained over
 
rice exhibited a near-normal morphology in terms of growth but a high rate of sterility (Fig. 1, A and B).Of 44 RNAi transgenic plants obtained over
 
three years (2005, 2006, and 2007), 33 had high rates of sterility (Fig. 1C).A semiquantitative reverse transcription (RT)-PCR assay revealed that the mRNA expression of endogenous OsDEES1 was significantly
 
three years (2005, 2006, and 2007), 33 had high rates of sterility (Fig. 1C).A semiquantitative reverse transcription (RT)-PCR assay revealed that the mRNA expression of endogenous OsDEES1 was significantly
down-regulated in our RNAi plants (Fig. 1D).
+
down-regulated in our RNAi plants (Fig. 1D)<ref name="ref1" />.
 
[[File:Fig 1.png|right|thumb|320px|'''Figure 1. Analysis of the sterile phenotype in the OsDEES1 RNAi transgenic rice plants.''' ]]
 
[[File:Fig 1.png|right|thumb|320px|'''Figure 1. Analysis of the sterile phenotype in the OsDEES1 RNAi transgenic rice plants.''' ]]
  
 
===Expression===
 
===Expression===
OsDEES1 exhibited a tissue-specific expression pattern in flowers and seedlings. In the ovary, OsDEES1 was expressed in the megagametophyte region and surrounding nucellus cells in the ovule near the micropylar region.OsDEES1pro::GUS construct was induced into rice plants by A. tumefaciensmediated callus transformation. Histochemical staining
+
OsDEES1 exhibited a tissue-specific expression pattern in flowers and seedlings. In the ovary, OsDEES1 was expressed in the megagametophyte region and surrounding nucellus cells in the ovule near the micropylar region.OsDEES1pro::GUS construct was induced into rice plants by A. tumefaciensmediated callus transformation<ref name="ref1" />. Histochemical staining revealed OsDEES1 expression in floral tissues(anthers, pistils, and lodicules) as well as in the coleoptile,node, and leaf tongue of seedlings, but not in the leaf blade or root(Fig. 2A).ovarian sections from OsDEES1pro::GUS transgenic plants were generated for immunohistochemical
revealed OsDEES1 expression in floral tissues(anthers, pistils, and lodicules) as well as in the coleoptile,node, and leaf tongue of seedlings, but not in the leaf blade or root(Fig. 2A).ovarian sections from OsDEES1pro::GUS transgenic plants were generated for immunohistochemical
+
analysis using anti-GUS antibodies. As shown in Figure2B, a strong GUS immunolocalization signal(brown) was detected in the ovule and lodicules (Fig.2Bb).In the enlarged image of the ovule, OsDEES1 expression can be seen in the megagametophyte region and surrounding nucellus cells near the micropyle (i.e.the area where the embryo sac formed and developed;Fig. 2Bc)<ref name="ref1" />.
analysis using anti-GUS antibodies. As shown in Figure2B, a strong GUS immunolocalization signal(brown) was detected in the ovule and lodicules (Fig.2Bb).In the enlarged image of the ovule, OsDEES1 expression can be seen in the megagametophyte region and surrounding nucellus cells near the micropyle (i.e.the area where the embryo sac formed and developed;Fig. 2Bc).
 
 
[[File:Fig 2.png|below|thumb|320px|'''Figure 2. OsDEES1 expression pattern in various plant tissues and immunolocalization in the ovary..''' ]]
 
[[File:Fig 2.png|below|thumb|320px|'''Figure 2. OsDEES1 expression pattern in various plant tissues and immunolocalization in the ovary..''' ]]
  
 
===Evolution===
 
===Evolution===
 
Online sequence analyses have shown that OsDEES1 possesses a typical receptor kinase structure, including an extracellular domain, a transmembrane domain,and an intracellular kinase domain (http://plantsp.
 
Online sequence analyses have shown that OsDEES1 possesses a typical receptor kinase structure, including an extracellular domain, a transmembrane domain,and an intracellular kinase domain (http://plantsp.
genomics.purdue.edu/feature_scan.html).the extracellular region of OsDEES1 has a signal peptide composed of 19 amino acids at the N terminus and two EGF repeat-like domains (EGF2 andEGF-Ca) near the transmembrane region. The typical ATP-binding motif and kinase active site can also be found in the intracellular domain (Fig. 3A). Phylogenetic tree analysis showed that OsDEES1 shares 41% identity with three Arabidopsis WAKs (AtWAK1, -2,and -4), whereas the three AtWAKs exhibited approximately 73% identity among themselves (Fig. 3B).Notably, compared with AtWAKs, OsDEES1 possesses an additional 42 amino acids in its extracellular domain but lacks 63 amino acids at its C terminus (Fig.3A).
+
genomics.purdue.edu/feature_scan.html).the extracellular region of OsDEES1 has a signal peptide composed of 19 amino acids at the N terminus and two EGF repeat-like domains (EGF2 andEGF-Ca) near the transmembrane region. The typical ATP-binding motif and kinase active site can also be found in the intracellular domain (Fig. 3A)<ref name="ref1" />. Phylogenetic tree analysis showed that OsDEES1 shares 41% identity with three Arabidopsis WAKs (AtWAK1, -2,and -4), whereas the three AtWAKs exhibited approximately 73% identity among themselves (Fig. 3B)<ref name="ref1" />.Notably, compared with AtWAKs, OsDEES1 possesses an additional 42 amino acids in its extracellular domain but lacks 63 amino acids at its C terminus (Fig.3A).
 +
 
 +
==Localization==
 +
The OsDEES1 gene product has a membranelocalizing signal peptide and is thus speculated to be a plasma membrane protein (http://cdna01.dna.
 +
affrc.go.jp/cDNA/).YFP was ubiquitously localized in the cytoplasm, whereas OsDEES1DK-YFP was localized to the plasma membrane region in tobacco cells. In onion cells after plasmolysis, OsDEES1DK-YFP was detected in the plasma membrane region, in the cell wall (long arrow), and in thread-like structures (short arrow) between the cell wall and plasma membrane<ref name="ref1" />. The right-most images offer enlarged views of the circumscribed region(Fig.3C).
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
*Hebei Key Laboratory of Molecular and Cellular Biology, College of Life Sciences, Hebei Normal University,Shijiazhuang 050016, China
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 
+
* <ref name="ref1">
==Structured Information==
+
Na Wang, Hui-Jia Huang, Su-Ting Ren,et al,.The Rice Wall-Associated Receptor-Like Kinase Gene OsDEES1 Plays a Role in Female Gametophyte Development[J].Plant Physiology,2012,160,696–707,
{{JaponicaGene|
+
</references>
GeneName = Os09g0561600|
+
== Structured Information ==
Description = EGF domain containing protein|
 
Version = NM_001070468.1 GI:115480678 GeneID:4347857|
 
Length = 2988 bp|
 
Definition = Oryza sativa Japonica Group Os09g0561600, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 9|Chromosome 9]]|
 
AP = Chromosome 9:23147405..23150392|
 
CDS = 23147423..23148569,23149076..23150091|
 
GCID = <gbrowseImage1>
 
name=NC_008402:23147405..23150392
 
source=RiceChromosome09
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008402:23147405..23150392
 
source=RiceChromosome09
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggcgatggcgatggcgatggcgctgctgctgctgctgcttctgcagctgtggtcggtggaagcgcaggtcgcagcgccgccgccggcgagctgcccggacaggtgcggcgacgtgagcgtgccgtacccgttcggcatccgcgacggctgccacctcccgggcttccgcctcacctgcgacgccacccacaccccgccgcgcctgatgctcggcaacggcaccctccaggtcgtcgacatctccctggccaactccaccgtgcgcgccctcgacctcgccggcgccgtcaacttcacctacgacgtgtcgaagctcgcccccagcggcagcggcacgtggtccagcctcggcaccgtcgccggcgccggcccgtacgtcgtctccgagcagcgcaaccggctcgtcgtcacgggctgcaacgtccaggccacgctcgccggggagaacaccaacatcatcggcggctgctcctccttctgcccggtcagcgagatgttcaccagcgtggcggcgaccgtccccgtcgtccccggcgccggcgccgacaacgccaccgatggcggcttcatctgctccggcaccagctgctgcgagacgcccatcgccatcggccgcccctcctacctcgtgcagttcctcagccttgaccagaaccaggagctcaccggcaagctccccgtcgccgtgcgcatcgccgagcgtgggtggttcgagggcgtcgccggcgagctgctcaacaccagctccgactccgccgccgccctccggacgccggtcccggtggtgctggagtgggtggtgtcgccgacgctggaggcggtgctgcagggcgtcaccgggcagttcgccgacgaccgcaactggtcgtgccccgcggacgcggcgaggagcgcatgccggagcagcaacagcttctgcagcaacgtcaccggcaactaccgccgcggctacgtgtgcaggtgccggcgaggctacggcgggaacccctacgtcgccggcggatgccaagacatcgacgagtgcaagctcgccgggaggtgctacggcgagtgcaccaacacgccgggagattaccagtgccggtgcccgcgcggcgctcgtggcgacccgcgcattccaaacggctgcgtcaaaactaatctaggtttaagtgttggtattggagttggcagtggagctgggcttttggtaatgggactgggcgctgcctttttaaaacgtaaggttaagaaacagagagcaagaatgctgaggcagaagttcttcaagcagaaccgaggtcatttgttgcaacaactagtgtctcagaaggctgacattgctgaaaggatgatcatccccttgtcagaactggagaaggccacaaacaattttgataaatcacgtgagcttggaggaggggggcacggcaccgtgtacaaagggattttatcggatcttcatgttgtcgcgatcaagaaatctaaggaggcagttcaaagagagattgacgagttcataaatgaggtagccattctctcgcaaatcaaccatcgtaatgtggtcaaactttttggatgttgtcttgagacagaagtgccattgctggtttatgaattcatatcaaatggtaccctttaccaccatcttcatgttgaaggaccaatgtcattgccatgggaagataggctcagaattgcaaccgaaaccgctagagcacttgcctaccttcactcagctgtgtcgttccctataatccacagggatatcaaatcccataacatcctattagatggttcactaacaacaaaagtgtccaattttggagcttcaaggtgcattccagctgaacaaactgggataacaaccgttgttcaaggaacactaggatatctggaccccatgtactactacacagggcgtctcactgagaaaagcgatgttttcagcttcggcgtcgttctaatagagttgcttactaggaagaaaccatactcatacagatcgcctgatgatgaaagtcttgtaacacatttcactgccctactcacacaaggcaacttgggcgacatacttgatcctcaggtcaaggaagagggaggcgaagaagttaaagagatagctgtgttagctgtggcatgtgccaagctgaaagtagaggagcggcctactatgaggtag</cdnaseq>|
 
AA = <aaseq>MAMAMAMALLLLLLLQLWSVEAQVAAPPPASCPDRCGDVSVPYP                    FGIRDGCHLPGFRLTCDATHTPPRLMLGNGTLQVVDISLANSTVRALDLAGAVNFTYD                    VSKLAPSGSGTWSSLGTVAGAGPYVVSEQRNRLVVTGCNVQATLAGENTNIIGGCSSF                    CPVSEMFTSVAATVPVVPGAGADNATDGGFICSGTSCCETPIAIGRPSYLVQFLSLDQ                    NQELTGKLPVAVRIAERGWFEGVAGELLNTSSDSAAALRTPVPVVLEWVVSPTLEAVL                    QGVTGQFADDRNWSCPADAARSACRSSNSFCSNVTGNYRRGYVCRCRRGYGGNPYVAG                    GCQDIDECKLAGRCYGECTNTPGDYQCRCPRGARGDPRIPNGCVKTNLGLSVGIGVGS                    GAGLLVMGLGAAFLKRKVKKQRARMLRQKFFKQNRGHLLQQLVSQKADIAERMIIPLS                    ELEKATNNFDKSRELGGGGHGTVYKGILSDLHVVAIKKSKEAVQREIDEFINEVAILS                    QINHRNVVKLFGCCLETEVPLLVYEFISNGTLYHHLHVEGPMSLPWEDRLRIATETAR                    ALAYLHSAVSFPIIHRDIKSHNILLDGSLTTKVSNFGASRCIPAEQTGITTVVQGTLG                    YLDPMYYYTGRLTEKSDVFSFGVVLIELLTRKKPYSYRSPDDESLVTHFTALLTQGNL                    GDILDPQVKEEGGEEVKEIAVLAVACAKLKVEERPTMR</aaseq>|
 
DNA = <dnaseqindica>19..1165#1672..2687#atcattcaaccaccggctatggcgatggcgatggcgatggcgctgctgctgctgctgcttctgcagctgtggtcggtggaagcgcaggtcgcagcgccgccgccggcgagctgcccggacaggtgcggcgacgtgagcgtgccgtacccgttcggcatccgcgacggctgccacctcccgggcttccgcctcacctgcgacgccacccacaccccgccgcgcctgatgctcggcaacggcaccctccaggtcgtcgacatctccctggccaactccaccgtgcgcgccctcgacctcgccggcgccgtcaacttcacctacgacgtgtcgaagctcgcccccagcggcagcggcacgtggtccagcctcggcaccgtcgccggcgccggcccgtacgtcgtctccgagcagcgcaaccggctcgtcgtcacgggctgcaacgtccaggccacgctcgccggggagaacaccaacatcatcggcggctgctcctccttctgcccggtcagcgagatgttcaccagcgtggcggcgaccgtccccgtcgtccccggcgccggcgccgacaacgccaccgatggcggcttcatctgctccggcaccagctgctgcgagacgcccatcgccatcggccgcccctcctacctcgtgcagttcctcagccttgaccagaaccaggagctcaccggcaagctccccgtcgccgtgcgcatcgccgagcgtgggtggttcgagggcgtcgccggcgagctgctcaacaccagctccgactccgccgccgccctccggacgccggtcccggtggtgctggagtgggtggtgtcgccgacgctggaggcggtgctgcagggcgtcaccgggcagttcgccgacgaccgcaactggtcgtgccccgcggacgcggcgaggagcgcatgccggagcagcaacagcttctgcagcaacgtcaccggcaactaccgccgcggctacgtgtgcaggtgccggcgaggctacggcgggaacccctacgtcgccggcggatgccaagacatcgacgagtgcaagctcgccgggaggtgctacggcgagtgcaccaacacgccgggagattaccagtgccggtgcccgcgcggcgctcgtggcgacccgcgcattccaaacggctgcgtcaaaactaatctaggtaactacacctacatttttctgctttgacatagtccaatttatgcacagatttttcaaagaatggaaaactaatctaggtactaataactgaaatatcctgctttacattgtcagtcaaatttatgcagagagctctgcaatgtagttctgttttatacagcagtctttctttaactgttcttccaagtacttgcatcgactactctgttttcatagactgatcttgcttttcttattaaccaaatggctgataaattattttacttgatagtgctagctctgcaatgaaactctgtttagtacatcagtctttctttaacagttcagtcaagtactagcaccaactgctctgtttcataaacacaagcatactactctgttttttcatagactaatctttccataacgttgtttttcttattaaccaactcccatattctagttcataggtgaaatatctaccaactctgatggagatttttgccttctcttgtgtgctaccaggtttaagtgttggtattggagttggcagtggagctgggcttttggtaatgggactgggcgctgcctttttaaaacgtaaggttaagaaacagagagcaagaatgctgaggcagaagttcttcaagcagaaccgaggtcatttgttgcaacaactagtgtctcagaaggctgacattgctgaaaggatgatcatccccttgtcagaactggagaaggccacaaacaattttgataaatcacgtgagcttggaggaggggggcacggcaccgtgtacaaagggattttatcggatcttcatgttgtcgcgatcaagaaatctaaggaggcagttcaaagagagattgacgagttcataaatgaggtagccattctctcgcaaatcaaccatcgtaatgtggtcaaactttttggatgttgtcttgagacagaagtgccattgctggtttatgaattcatatcaaatggtaccctttaccaccatcttcatgttgaaggaccaatgtcattgccatgggaagataggctcagaattgcaaccgaaaccgctagagcacttgcctaccttcactcagctgtgtcgttccctataatccacagggatatcaaatcccataacatcctattagatggttcactaacaacaaaagtgtccaattttggagcttcaaggtgcattccagctgaacaaactgggataacaaccgttgttcaaggaacactaggatatctggaccccatgtactactacacagggcgtctcactgagaaaagcgatgttttcagcttcggcgtcgttctaatagagttgcttactaggaagaaaccatactcatacagatcgcctgatgatgaaagtcttgtaacacatttcactgccctactcacacaaggcaacttgggcgacatacttgatcctcaggtcaaggaagagggaggcgaagaagttaaagagatagctgtgttagctgtggcatgtgccaagctgaaagtagaggagcggcctactatgaggtaggtggagatgacactcgaaagtgttcgattgtcatcacagcagcaagagcatggtgtgggtgcaaagaaatccagggagaatcatgtctcctggagctacccggtaagtgagggtacaagtacacaatcaactagacaatatagccttgaagaagagtatttgttgtcatcaaggtttcccagataatggatttttttttctggagtggttttggatcaatagaaagagttgtcacaatgtacaaggcatatgatatgcatgattttcatagctaaatgtgcactgttttattgttcttctt</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001070468.1 RefSeq:Os09g0561600]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 13:17, 8 May 2017

Please input one-sentence summary here.

Annotated Information

Function

OsDEES1,a rice WAK-RLK gene,plays a role in rice sexual reproduction by regulating female gametophyte development.OsDEES1 silencing by RNA interference caused a high rate of female sterility[1]. Crossing experiments showed that female reproductive organs lacking OsDEES1 carried a functional defect[1].

The phenotype of OsDEES1 RNA interference plants

the knockdown of OsDEES1 expression did not affect megasporogenesis but that it disturbed female gametophyte formation, resulting in a degenerated embryo sac and defective seed formation.The RNAi transgenic rice exhibited a near-normal morphology in terms of growth but a high rate of sterility (Fig. 1, A and B).Of 44 RNAi transgenic plants obtained over three years (2005, 2006, and 2007), 33 had high rates of sterility (Fig. 1C).A semiquantitative reverse transcription (RT)-PCR assay revealed that the mRNA expression of endogenous OsDEES1 was significantly down-regulated in our RNAi plants (Fig. 1D)[1].

Figure 1. Analysis of the sterile phenotype in the OsDEES1 RNAi transgenic rice plants.

Expression

OsDEES1 exhibited a tissue-specific expression pattern in flowers and seedlings. In the ovary, OsDEES1 was expressed in the megagametophyte region and surrounding nucellus cells in the ovule near the micropylar region.OsDEES1pro::GUS construct was induced into rice plants by A. tumefaciensmediated callus transformation[1]. Histochemical staining revealed OsDEES1 expression in floral tissues(anthers, pistils, and lodicules) as well as in the coleoptile,node, and leaf tongue of seedlings, but not in the leaf blade or root(Fig. 2A).ovarian sections from OsDEES1pro::GUS transgenic plants were generated for immunohistochemical analysis using anti-GUS antibodies. As shown in Figure2B, a strong GUS immunolocalization signal(brown) was detected in the ovule and lodicules (Fig.2Bb).In the enlarged image of the ovule, OsDEES1 expression can be seen in the megagametophyte region and surrounding nucellus cells near the micropyle (i.e.the area where the embryo sac formed and developed;Fig. 2Bc)[1].

Figure 2. OsDEES1 expression pattern in various plant tissues and immunolocalization in the ovary..

Evolution

Online sequence analyses have shown that OsDEES1 possesses a typical receptor kinase structure, including an extracellular domain, a transmembrane domain,and an intracellular kinase domain (http://plantsp. genomics.purdue.edu/feature_scan.html).the extracellular region of OsDEES1 has a signal peptide composed of 19 amino acids at the N terminus and two EGF repeat-like domains (EGF2 andEGF-Ca) near the transmembrane region. The typical ATP-binding motif and kinase active site can also be found in the intracellular domain (Fig. 3A)[1]. Phylogenetic tree analysis showed that OsDEES1 shares 41% identity with three Arabidopsis WAKs (AtWAK1, -2,and -4), whereas the three AtWAKs exhibited approximately 73% identity among themselves (Fig. 3B)[1].Notably, compared with AtWAKs, OsDEES1 possesses an additional 42 amino acids in its extracellular domain but lacks 63 amino acids at its C terminus (Fig.3A).

Localization

The OsDEES1 gene product has a membranelocalizing signal peptide and is thus speculated to be a plasma membrane protein (http://cdna01.dna. affrc.go.jp/cDNA/).YFP was ubiquitously localized in the cytoplasm, whereas OsDEES1DK-YFP was localized to the plasma membrane region in tobacco cells. In onion cells after plasmolysis, OsDEES1DK-YFP was detected in the plasma membrane region, in the cell wall (long arrow), and in thread-like structures (short arrow) between the cell wall and plasma membrane[1]. The right-most images offer enlarged views of the circumscribed region(Fig.3C).

Labs working on this gene

  • Hebei Key Laboratory of Molecular and Cellular Biology, College of Life Sciences, Hebei Normal University,Shijiazhuang 050016, China

References

  1. 1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 Cite error: Invalid <ref> tag; no text was provided for refs named ref1

Structured Information