Difference between revisions of "Os09g0537700"

From RiceWiki
Jump to: navigation, search
(Evolution)
 
(13 intermediate revisions by 3 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os09g0537700''''' was reported as '''''OsRNS4''''' in 2014 by researchers from China.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os02g0187800''''' '''''<=>''''' '''''OsRNS4, OsRRP, RNaseDIS'''''
 +
 
===Function===
 
===Function===
OsRNS4 is an s-like Rnase gene. It related to the abscisic acid (ABA)-mediated responses and phytochrome-mediated light responses as well as salinity tolerance in rice. Recent study show that OsRNS4-OX lines have enhanced tolerance to high salinity compared to wild type and regulate photosensitivity and abiotic stress responses. OsRNS4 probably acts as a positive regulator in ABA responses in rice seedlings.
+
* S-like ribonucleases (S-like RNases) are homologous to S-ribonucleases (S-RNases), but are not involved in self-incompatibility.  
 +
* In dicotyledonous plants, S-like RNases play an important role in phosphate recycling during senescence and are induced by inorganic phosphate-starvation and in response to defense and mechanical wounding.
 +
 
 +
===Phenotypic analysis===
 +
* The seedlings overexpressing OsRNS4 had longer coleoptiles and first leaves than wild-type seedlings under red light (R) and far-red light (FR), suggesting negative regulation of OsRNS4 in photomor-phogenesis in rice seedlings.
 +
* Moreover, ABA-induced growth inhibition of rice seedlings was significantly increased in the OsRNS4-overexpression (OsRNS4-OX) lines compared with that in WT, suggesting that OsRNS4 probably acts as a positive regulator in ABA responses in rice seedlings.
 +
* In addition, our results demonstrate that OsRNS4-OX lines have enhanced tolerance to high salinity compared to WT.
  
 
===Expression===
 
===Expression===
The OsRNS4 gene was expressed at relatively high levels in leaves although its transcripts were detected in various organs. OsRNS4 expression was regulated by salt, PEG and ABA.  The seedlings overexpressing OsRNS4 had longer coleoptiles and first leaves than wild-type seedlings under red light and far-red light, suggesting negative regulation of OsRNS4 in photomorphogenesis in rice seedlings. Moreover, ABA-induced growth inhibition of rice seedlings was significantly increased in the OsRNS4-overexpression lines compared with that in wild type.
+
* The OsRNS4 gene was expressed at relatively high levels in leaves although its transcripts were detected in various organs. OsRNS4 expression was regulated by salt, PEG and ABA.
  
 
===Evolution===
 
===Evolution===
There was not paper about the gene evolution.
+
* The process of genome evolution by duplication in each species appears to have been quite different. Functional classifications of the proteins based on Gene Ontology (GO) annotations are shown in Figure 2; the numbers of known functional domains were not significantly different between the two species.
 
 
You can also add sub-section(s) at will.
 
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* Shandong Rice Research Institute, Shandong Academy of Agricultural Sciences, Jinan 250100, China
Shandong Natural Science Funds for Distinguished Young Scholars (JQ200911)
+
* Shandong Provincial Key Laboratory of Crop Genetic Improvement, Ecology and Physiology, 250100 Jinan, China
 
 
the Chinese National Natural Science Foundations (30971744 and 31270232)
 
 
the RGRC (Rice Genome Resource Center) in Japan
 
  
 
==References==
 
==References==
Zheng, J., Wang, Y.Y., He, Y.A., Zhou, J.J., Li, Y.P., Liu, Q.Q., and Xie, X.Z. (2014). Overexpression of an S-like ribonuclease gene, OsRNS4, confers enhanced tolerance to high salinity and hyposensitivity to phytochrome-mediated light signals in rice. Plant Sci 214, 99-105.
+
* (2005). The map-based sequence of the rice genome. Nature 436, 793-800.
 +
* Itoh, T., Tanaka, T., Barrero, R.A., Yamasaki, C., Fujii, Y., Hilton, P.B., Antonio, B.A., Aono, H., Apweiler, R., Bruskiewich, R., et al. (2007). Curated genome annotation of Oryza sativa ssp. japonica and comparative genome analysis with Arabidopsis thaliana. Genome research 17, 175-183.
 +
* Ohyanagi, H., Tanaka, T., Sakai, H., Shigemoto, Y., Yamaguchi, K., Habara, T., Fujii, Y., Antonio, B.A., Nagamura, Y., Imanishi, T., et al. (2006). The Rice Annotation Project Database (RAP-DB): hub for Oryza sativa ssp. japonica genome information. Nucleic acids research 34, D741-744.
 +
* Tanaka, T., Antonio, B.A., Kikuchi, S., Matsumoto, T., Nagamura, Y., Numa, H., Sakai, H., Wu, J., Itoh, T., Sasaki, T., et al. (2008). The Rice Annotation Project Database (RAP-DB): 2008 update. Nucleic acids research 36, D1028-1033.
 +
* Zheng, J., Wang, Y.Y., He, Y.A., Zhou, J.J., Li, Y.P., Liu, Q.Q., and Xie, X.Z. (2014). Overexpression of an S-like ribonuclease gene, OsRNS4, confers enhanced tolerance to high salinity and hyposensitivity to phytochrome-mediated light signals in rice. Plant Sci 214, 99-105.
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os09g0537700|
 
Description = Ribonuclease T2 family protein|
 
Version = NM_001070328.1 GI:115480398 GeneID:4347708|
 
Length = 1983 bp|
 
Definition = Oryza sativa Japonica Group Os09g0537700, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 9|Chromosome 9]]|
 
AP = Chromosome 9:21987605..21989587|
 
CDS = 21987863..21988152,21988266..21988458,21988542..21988703,21989419..21989532|
 
GCID = <gbrowseImage1>
 
name=NC_008402:21987605..21989587
 
source=RiceChromosome09
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008402:21987605..21989587
 
source=RiceChromosome09
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggagcagaggaaatttttgttgtgcctaattcttggcttacttgcgacttcaggacctgccaagaccgtcaatgctgactcgccctttgatttttattatctcatcctcatgtggcctggagcatactgcactgacagcgagtatggttgttgcgtgcccaagtatggttacccgtcagaagatttcttcgtcaagagcttcatgacctttgactcgtcagagaacacagctgttgtcaggtgcaactccgacaatcctttcgacattaacaagctagactcaatcgagaacaacctgaaccactactggagcaacatcaagtgtcctcgcaccgacggcgtgaactcatggaagagcgagtggaacagctatggcgtctgctccggcctcaaggagttggactacttcaaggccggtctccagctcagaaagaacgcagatgttctctctgctctcgctgaacaaggcatcaagccggactaccaactgtacaacacggcgttcatcaagtgggcagtgaaccagaagctgggtgtgacaccaggagtgcagtgcagggacgggccatttgggaagaagcagttgtacgagatctacctctgcgtcgacaaggacgccaagagcttcatcgactgccctgtcctgcccaacctcagctgccctgccgaggtgctcttccatccgttccacacctggatgctcaacaccacatcggctgccaacatcgtgatgcccactgaaactgtgctggcctaa</cdnaseq>|
 
AA = <aaseq>MEQRKFLLCLILGLLATSGPAKTVNADSPFDFYYLILMWPGAYC                    TDSEYGCCVPKYGYPSEDFFVKSFMTFDSSENTAVVRCNSDNPFDINKLDSIENNLNH                    YWSNIKCPRTDGVNSWKSEWNSYGVCSGLKELDYFKAGLQLRKNADVLSALAEQGIKP                    DYQLYNTAFIKWAVNQKLGVTPGVQCRDGPFGKKQLYEIYLCVDKDAKSFIDCPVLPN                    LSCPAEVLFHPFHTWMLNTTSAANIVMPTETVLA</aaseq>|
 
DNA = <dnaseqindica>1436..1725#1130..1322#885..1046#56..169#aaccaacaagcaagaagaaatttctctccttgtagaaacaagcctagagagtactatggagcagaggaaatttttgttgtgcctaattcttggcttacttgcgacttcaggacctgccaagaccgtcaatgctgactcgccctttgatttttattatctcatcctcatggtatgaactgcgaatcatcaaatatttaacttcttgcaatgatacgcattaagtttagttataaactatgactacctttttcttatttacactttcttattcaaattaatgaaaaagattctatgtttgtaattcttattagtattacataaaacttctgttcaaggatatgcatgttgtacatgatgtactattggcatctaaccttattattcacgtgaattaagaatttgtaaaattatgaaagtttcctcagaacaagtatatcatctttttttttacaaaatagaaatattaatatcacataaacagcctaaatggacaaattagctgtacgagattttgctactgtcctgtgttcttgctaaaacggaggtcaaagaatgaaagcacgacaaacgagcacatcaacatatttgaacatgcacagcaagcaggagctgcaagacaatatcgacaaaatctactgtgatatatatgacaaaagtctgatgaagtttcaacaatgttgatttagagcatactcatatcaatagtacgtaaaaccagtaaggaaattcaactagaagatatatatctcataggattcaggactcagccccaaacgagggggaaaatttcaaactgaaacgcagagcaaatataaatgatctctagctcaatagctcagcagtttccatggtgagtataaatcgattcgcattcgtgcctgcagtggcctggagcatactgcactgacagcgagtatggttgttgcgtgcccaagtatggttacccgtcagaagatttcttcgtcaagagcttcatgacctttgactcgtcagagaacacagctgttgtcaggtgcaactccgacaatcctttcgacattaacaaggttagcacacattaatttacaagctagcagtctcatttaattagcttcatgtctgtaaatatataattacatgtatattgcagctagactcaatcgagaacaacctgaaccactactggagcaacatcaagtgtcctcgcaccgacggcgtgaactcatggaagagcgagtggaacagctatggcgtctgctccggcctcaaggagttggactacttcaaggccggtctccagctcagaaagaacgcagatgttctctctgctctcgctgaacaaggtacatgtacaaatcataccgacacaccatttagtagtttaaaaaacatacgcgctaatgaaaaccgaggtaaaatctgtgtctgaatgctttttgggccgatggatgaataggcatcaagccggactaccaactgtacaacacggcgttcatcaagtgggcagtgaaccagaagctgggtgtgacaccaggagtgcagtgcagggacgggccatttgggaagaagcagttgtacgagatctacctctgcgtcgacaaggacgccaagagcttcatcgactgccctgtcctgcccaacctcagctgccctgccgaggtgctcttccatccgttccacacctggatgctcaacaccacatcggctgccaacatcgtgatgcccactgaaactgtgctggcctaattaagagcctttaatttgctagctaagctgccatgatctacttgatcaacctgtcctaagagcatgtagcatatgcttagcttgttgctttgggtgaataatcgcgcaacttttatacattgttgtgccctctgaataatatgtgcagtactatatatgaagtattgtaccgcatatgttatgtattacatgtgcaggtcttgtgcacacctgtgaggtgaatggatatattatgaatatataacgtgttgtattatg</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001070328.1 RefSeq:Os09g0537700]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 15:57, 8 May 2017

The rice Os09g0537700 was reported as OsRNS4 in 2014 by researchers from China.

Annotated Information

Gene Symbol

  • Os02g0187800 <=> OsRNS4, OsRRP, RNaseDIS

Function

  • S-like ribonucleases (S-like RNases) are homologous to S-ribonucleases (S-RNases), but are not involved in self-incompatibility.
  • In dicotyledonous plants, S-like RNases play an important role in phosphate recycling during senescence and are induced by inorganic phosphate-starvation and in response to defense and mechanical wounding.

Phenotypic analysis

  • The seedlings overexpressing OsRNS4 had longer coleoptiles and first leaves than wild-type seedlings under red light (R) and far-red light (FR), suggesting negative regulation of OsRNS4 in photomor-phogenesis in rice seedlings.
  • Moreover, ABA-induced growth inhibition of rice seedlings was significantly increased in the OsRNS4-overexpression (OsRNS4-OX) lines compared with that in WT, suggesting that OsRNS4 probably acts as a positive regulator in ABA responses in rice seedlings.
  • In addition, our results demonstrate that OsRNS4-OX lines have enhanced tolerance to high salinity compared to WT.

Expression

  • The OsRNS4 gene was expressed at relatively high levels in leaves although its transcripts were detected in various organs. OsRNS4 expression was regulated by salt, PEG and ABA.

Evolution

  • The process of genome evolution by duplication in each species appears to have been quite different. Functional classifications of the proteins based on Gene Ontology (GO) annotations are shown in Figure 2; the numbers of known functional domains were not significantly different between the two species.

Labs working on this gene

  • Shandong Rice Research Institute, Shandong Academy of Agricultural Sciences, Jinan 250100, China
  • Shandong Provincial Key Laboratory of Crop Genetic Improvement, Ecology and Physiology, 250100 Jinan, China

References

  • (2005). The map-based sequence of the rice genome. Nature 436, 793-800.
  • Itoh, T., Tanaka, T., Barrero, R.A., Yamasaki, C., Fujii, Y., Hilton, P.B., Antonio, B.A., Aono, H., Apweiler, R., Bruskiewich, R., et al. (2007). Curated genome annotation of Oryza sativa ssp. japonica and comparative genome analysis with Arabidopsis thaliana. Genome research 17, 175-183.
  • Ohyanagi, H., Tanaka, T., Sakai, H., Shigemoto, Y., Yamaguchi, K., Habara, T., Fujii, Y., Antonio, B.A., Nagamura, Y., Imanishi, T., et al. (2006). The Rice Annotation Project Database (RAP-DB): hub for Oryza sativa ssp. japonica genome information. Nucleic acids research 34, D741-744.
  • Tanaka, T., Antonio, B.A., Kikuchi, S., Matsumoto, T., Nagamura, Y., Numa, H., Sakai, H., Wu, J., Itoh, T., Sasaki, T., et al. (2008). The Rice Annotation Project Database (RAP-DB): 2008 update. Nucleic acids research 36, D1028-1033.
  • Zheng, J., Wang, Y.Y., He, Y.A., Zhou, J.J., Li, Y.P., Liu, Q.Q., and Xie, X.Z. (2014). Overexpression of an S-like ribonuclease gene, OsRNS4, confers enhanced tolerance to high salinity and hyposensitivity to phytochrome-mediated light signals in rice. Plant Sci 214, 99-105.

Structured Information