Difference between revisions of "Os06g0157500"

From RiceWiki
Jump to: navigation, search
(Function)
(Annotated Information)
 
(13 intermediate revisions by 4 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os06g0157500''''' was reported as '''''RFT1''''' in 2009 <ref name="ref1" /> by researchers from China.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
[[File:Fig. 2. A model for the photoperiodic control of flowering in rice.jpg|right|thumb|427px|'''Fig.2''' ''A model for the photoperiodic control of flowering in rice. (from reference<ref name="ref1" />).'']]
 +
===Gene Symbol===
 +
*'''''Os06g0157500''''' '''''<=>''''' ''''' OsFTL3, OsRFT1, RFT'''''
 +
 
===Function===
 
===Function===
FLOWERING LOCUS T 1 (RFT1) is a florigen gene in rice  (Figure 1), because an RFT1:GFP fusion protein localized in the shoot apical meristem (SAM) under LD conditions (Figure 2). RFT1 is the closest homolog to Heading date 3a (Hd3a) and is a major floral activator under LD conditions..RFT1 and Hd3a regulate rice flowering under LD and SD conditions.OsMADS50, an LD floral activator, acts upstream of Ehd1 and RFT1.OsMADS14 and OsMADS15 act downstream of RFT1 in the SAM under LD conditions.Both positive (OsMADS50 and Ehd1) and negative (Hd1, phyB and Ghd7) regulators of RFT1 form a gene network that regulates LD flowering in rice The OsMADS50-Ehd1-RFT1 pathway is involved in floral activation under LD conditions(Figure 2 )<ref name="ref1" />.
+
* RFT1 promotes flowering in the absence of Hd3a, and that both Hd3a and RFT1 are essential for flowering under SD conditions. <ref name="ref1" />.
 
+
* RFT1 is essential for LD flowering.
[[File:Fig.1. RFT1 encodes LD florigen.jpg|right|thumb|250px|''Fig.1'''' ''. RFT1 encodes LD florigen. (from reference<ref name="ref1" />).'']]
+
* Both positive (OsMADS50 and Ehd1) and negative (Hd1, phyB and Ghd7) regulators of RFT1 form a gene network that regulates LD flowering in rice.
[[File:Fig. 2. A model for the photoperiodic control of flowering in rice.jpg|center|thumb|650px|'''Fig.2.''' ''. A model for the photoperiodic control of flowering in rice. (from reference<ref name="ref1" />).'']]
 
  
 
===Mutation===
 
===Mutation===
Polymorphisms in the promoter region that lead to reduced expression levels of RFT1. An amino acid substitution (E105K) that leads to a functional defect in Nona Bokra RFT1. The E105K mutation is found only in indica, and a strong association was founded between the RFT1 haplotype and extremely late flowering in a functional Hd1 background.. Furthermore, SNPs in the regulatory region of RFT1 and the E105K substitution in 1,397 accessions show strong linkage disequilibrium with a flowering time–associated SNP.  <ref name="ref2" /> .
+
* Mutants in OsMADS50, a rice ortholog of Arabidopsis SUPPRESOR OF OVEREXPRESSION OF CONSTANS 1 (SOC1) did not flower up to 300 days after sowing under LD conditions, indicating that OsMADS50, which acts upstream of RFT1, promotes flowering under LD conditions.
 +
* A rice ortholog of Arabidopsis APETALA1, OsMADS14, was expressed in the floral meristem in wild-type but not in RFT1 RNAi plants, suggesting that OsMADS14 is activated by RFT1 protein in the SAM after the transition to flowering.
  
 
===Expression===
 
===Expression===
Developmental expression of RFT1 in the SAM under LD conditions through stages 1-5 (Figure 3 ) <ref name="ref1" />.  
+
* Transcript levels of RFT1 were very low in wild-type plants throughout development. The similarity of Hd3a and RFT1 expression patterns under SD and LD conditions, and in vascular tissues, suggests that RFT1 could function redundantly with Hd3a in promoting floral transition under SD conditions[3].
 +
 
 +
===Subcellular localization===
 +
* An RFT1:GFP fusion protein localized in the shoot apical meristem (SAM) under LD conditions, suggesting that RFT1 is a florigen gene in rice.
  
 
===Evolution===
 
===Evolution===
The ratios of nonsynonymous to synonymous substitutions suggest that the E105K mutation resulting in the defect in RFT1 occurred relatively recently. These findings indicate that natural mutations in RFT1 provide flowering time divergence under long-day conditions <ref name="ref2" /> .
+
* RFT1 is the closest homolog of 13 FT-like genes in rice to Hd3a, with 91% identity in their deduced amino acid sequences and is located only 11.5 kb from Hd3a on chromosome 6
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Line 32: Line 39:
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os06g0157500|
 
Description = Similar to CiFT protein|
 
Version = NM_001063394.1 GI:115466519 GeneID:4340184|
 
Length = 1652 bp|
 
Definition = Oryza sativa Japonica Group Os06g0157500, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|
 
AP = Chromosome 6:2925824..2927475|
 
CDS = 2926081..2926284,2926432..2926493,2926607..2926647,2927174..2927403|
 
GCID = <gbrowseImage1>
 
name=NC_008399:2925824..2927475
 
source=RiceChromosome06
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008399:2925824..2927475
 
source=RiceChromosome06
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggccggcagcggcagggacgatcctcttgtggttggcaggattgtgggtgatgtgctggatccattcgtccggatcactaacctcagtgtcagctatggtgcaaggatcgtctccaatggctgcgagctcaagccgtccatggtgacccaacagcccagggtcgtggtcggtggcaatgacatgaggacgttctacacactcgtgatggtagacccggatgctccgagcccaagcaaccctaaccttagggagtatctacactggctggtcaccgatattcctggtaccactggagcaacatttgggcaagaggtgatgtgctacgagagcccaaggccaaccatggggatccaccggctggtgttcgtgctgttccagcagctggggcgtcagacggtgtacgcaccggggtggcgccagaacttcagcaccaggaacttcgccgagctctacaacctcggctcgccggtcgccaccgtctacttcaactgccagcgcgaggccggctccggcggcaggagggtctacccctag</cdnaseq>|
 
AA = <aaseq>MAGSGRDDPLVVGRIVGDVLDPFVRITNLSVSYGARIVSNGCEL                    KPSMVTQQPRVVVGGNDMRTFYTLVMVDPDAPSPSNPNLREYLHWLVTDIPGTTGATF                    GQEVMCYESPRPTMGIHRLVFVLFQQLGRQTVYAPGWRQNFSTRNFAELYNLGSPVAT                    VYFNCQREAGSGGRRVYP</aaseq>|
 
DNA = <dnaseqindica>258..461#609..670#784..824#1351..1580#cctgtcactgtttggctagcttaaccttcctgacatctatcctctggattgaacggcaggagatacctaagctagctagcaatctctatcgatctgtttgtttacatgttcagttaaaggttactgagaaatgcctagagtttttccggctagcttcataagttagtgggttagctgacctagattcaaagtctaatccttttatttatttgatattagatatcctaacgtttttagttagaggttattaatttgacatggccggcagcggcagggacgatcctcttgtggttggcaggattgtgggtgatgtgctggatccattcgtccggatcactaacctcagtgtcagctatggtgcaaggatcgtctccaatggctgcgagctcaagccgtccatggtgacccaacagcccagggtcgtggtcggtggcaatgacatgaggacgttctacacactcgtacggatcatatcttggatgcagagacccaccagaagttatttaattactttcattaattatcataaaactagactataaattatattttttacatggatgcatgttaattttgtgtggcttacgtactaatctaattacctacaggtgatggtagacccggatgctccgagcccaagcaaccctaaccttagggagtatctacactggtaggcaccgatcagatatgttagctagctaattgtatacattcgtcctagaatataaagaatttggaccggattctcaatcattcgcgttgattctctttgtctgtctgtaggctggtcaccgatattcctggtaccactggagcaacatttggtcagtaaactagtatatatatatagtactcatatcaatttcgatgtaacagcaacatatgtggcagttccatgaatttttattaccttggtcctaccccatatatatacttcaaaaattgcataatgacaaaattatactccctccgtattttaatgtatgacgccgttgactttttaaccaacatttgaccattcgtcttatttaaattttttatgcaaatacaaaaatacttatgtcatgcttaaagaacatttgatgataaatcaagtcacaataaaataaatgataattacataatttttttgaataagacaaaaagtcaaacgtttgttaaaaagtcaatgtcgtcatacattaaaatacggagggagtatctattttgtcaaaaattttcgtcagatttgaaggatagggctgtacttcttctatgccaaaatggagggtggtgatcccctcaaaacttgtagaacagccactgttgatatatatatggtgaataacgtagataattaaattgatgcagggcaagaggtgatgtgctacgagagcccaaggccaaccatggggatccaccggctggtgttcgtgctgttccagcagctggggcgtcagacggtgtacgcaccggggtggcgccagaacttcagcaccaggaacttcgccgagctctacaacctcggctcgccggtcgccaccgtctacttcaactgccagcgcgaggccggctccggcggcaggagggtctacccctagctagctacgcatgccacccggcctccatgcatgcagcagctatagctaagctgagacctgcctagctgtata</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063394.1 RefSeq:Os06g0157500]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 03:14, 12 May 2017

The rice Os06g0157500 was reported as RFT1 in 2009 [1] by researchers from China.

Annotated Information

Fig.2 A model for the photoperiodic control of flowering in rice. (from reference[1]).

Gene Symbol

  • Os06g0157500 <=> OsFTL3, OsRFT1, RFT

Function

  • RFT1 promotes flowering in the absence of Hd3a, and that both Hd3a and RFT1 are essential for flowering under SD conditions. [1].
  • RFT1 is essential for LD flowering.
  • Both positive (OsMADS50 and Ehd1) and negative (Hd1, phyB and Ghd7) regulators of RFT1 form a gene network that regulates LD flowering in rice.

Mutation

  • Mutants in OsMADS50, a rice ortholog of Arabidopsis SUPPRESOR OF OVEREXPRESSION OF CONSTANS 1 (SOC1) did not flower up to 300 days after sowing under LD conditions, indicating that OsMADS50, which acts upstream of RFT1, promotes flowering under LD conditions.
  • A rice ortholog of Arabidopsis APETALA1, OsMADS14, was expressed in the floral meristem in wild-type but not in RFT1 RNAi plants, suggesting that OsMADS14 is activated by RFT1 protein in the SAM after the transition to flowering.

Expression

  • Transcript levels of RFT1 were very low in wild-type plants throughout development. The similarity of Hd3a and RFT1 expression patterns under SD and LD conditions, and in vascular tissues, suggests that RFT1 could function redundantly with Hd3a in promoting floral transition under SD conditions[3].

Subcellular localization

  • An RFT1:GFP fusion protein localized in the shoot apical meristem (SAM) under LD conditions, suggesting that RFT1 is a florigen gene in rice.

Evolution

  • RFT1 is the closest homolog of 13 FT-like genes in rice to Hd3a, with 91% identity in their deduced amino acid sequences and is located only 11.5 kb from Hd3a on chromosome 6

Labs working on this gene

  • Genetic Resources Center, National Institute of Agrobiological Sciences, Kannondai Tsukuba, Ibaraki, Japan[2] .
  • Institute of Crop Sciences, National Agriculture and Food Research Organization, Tsukuba, Ibaraki, Japan[2] .
  • Iwate Agricultural Research Center, Narita, Kitakami, Iwate, Japan[2] .
  • National Institute of Genetics, 111-1 Yata, Mishima 411-8540,Japan [1].
  • Faculty of Agriculture, Iwate University, Morioka 020-8550, Japan [1].

References

  1. 1.0 1.1 1.2 1.3 1.4 Reina Komiya*, Shuji Yokoi and Ko Shimamoto. A gene network for long-day flowering activates RFT1 encoding a mobile flowering signal in rice .Development 136, 3443-3450 (2009) doi:10.1242/dev.040170.
  2. 2.0 2.1 2.2 Ogiso-Tanaka E, Matsubara K, Yamamoto S-i, Nonoue Y, Wu J, et al. (2013) Natural Variation of the RICE FLOWERING LOCUS T 1 Contributes to Flowering Time Divergence in Rice. PLoS ONE 8(10): e75959. doi:10.1371/journal.pone.0075959

Structured Information