Difference between revisions of "Os02g0610500"

From RiceWiki
Jump to: navigation, search
(Function)
(Expression)
 
(41 intermediate revisions by 2 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
 
  
 +
Plants recognize environmental factors to determine flowering time. CONSTANS (CO) plays a central role in the photoperiod flowering pathway of Arabidopsis, and CO protein stability is modulated by photoreceptor.
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os02g0610500''''' '''''<=>''''' '''''OsBBX5, OsCCT06, OsCOL4, OsCOL4/OsD, OsD'''''
 +
===function===
 +
[[File:Figure1.jpg|right|thumb|275px|'''Figure 1.''' ''  Phenotypes of oscol4-1, oscol4-2, and WT at heading stage .(from reference)<ref name="ref1" />).'']]
  
OsCOL4, a member of the CONSTANS-like (COL) family in rice.OsCOL4 is a constitutive repressorfunctioning upstream of Ehd1 and functions independently from previously reported flowering pathways. In osphyB mutants, OsCOL4 expression was decreased and osphyB oscol4 double mutants flowered at the same time as the osphyB single mutants,
+
* OsCOL4 is a member of the CONSTANS-like (COL) family in rice.
indicating OsCOL4 functions downstream of OsphyB.
+
* OsCOL4 is a constitutive repressorfunctioning upstream of Ehd1 and functions independently from previously reported flowering pathways.  
 +
 
 +
===Phenotypic analysis===
 +
* In osphyB mutants, OsCOL4 expression was decreased and osphyB oscol4 double mutants flowered at the same time as the osphyB single mutants,indicating OsCOL4 functions downstream of OsphyB.<ref name="ref1" />
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
* OsCOL4 null mutants flowered early under short or long days. In contrast, OsCOL4 activation-tagging mutants (OsCOL4-D) flowered late in either environment.
 +
* Transcripts of Ehd1, Hd3a, and RFT1 were increased in the oscol4 mutants, but reduced in the OsCOL4-D mutants.
 +
* By comparison, levels of Hd1, OsID1, OsMADS50, OsMADS51, and OsMADS56 transcripts were not significantly changed in oscol4 or OsCOL4-D.
 +
* In osphyB mutants, OsCOL4 expression was decreased and osphyB oscol4 double mutants flowered at the same time as the osphyB single mutants<ref name="ref1" />
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
 
  
You can also add sub-section(s) at will.
+
* Plants recognize environmental factors to determine flowering time. CONSTANS (CO) plays a central role in the photoperiod flowering pathway of Arabidopsis, and CO protein stability is modulated by photoreceptor<ref name="ref1" />s.
 +
* In the former, GIGANTEA (GI) activates CONSTANS (CO), which promotes Flowering Locus T (FT) expression<ref name="ref2" />. The CO gene is a member of a B-box transcription factor family which contains a CCT (CO, CO-like, and TOC1) domain at the C-terminal end<ref name="ref3" /> .
 +
* In rice, Hd1, an ortholog of CO, acts as a flowering promoter, and phytochromes repress Hd1 expression.The rice genome contains 16 OsCOL genes <ref name="ref4" />. Among them, Hd1 was identified first via QTL analyses <ref name="ref5" />.
 +
* Two groups of rice COL proteins differ from those in Arabidopsis <ref name="ref4" />.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
*Department of Life Science, Pohang University of Science and Technology (POSTECH), Pohang 790–784, Korea
 +
*Crop Biotech Institute, Kyung Hee University, Yongin 446–701, Korea
 +
*Department of Plant Systems Biotech, Kyung Hee University, Yongin 446–701, Korea
 +
*Gyeongsang National University, Korea
 +
*the Plant Functional Genomics Laboratory at the POSTECH
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
<ref name="ref1">Yang-Seok Lee; Dong-Hoon Jeong; Dong-Yeon Lee;(2010)OsCOL4 is a constitutive flowering repressor upstream of Ehd1 and downstream of OsphyB  The Plant Journal,  63(1): 18-30</ref>
 +
<ref name="ref2">Yanovsky, M.J. and Kay, S.A. (2002) Molecular basis of seasonal time measurement in Arabidopsis. Nature, 419, 308–312</ref>
 +
<ref name="ref3">Robson, F., Costa, M.M.R., Hepworth, S.R.. (2001) Functional importance of conserved domains in the flowering-time gene CONSTANS demonstrated by analysis of mutant alleles and transgenic plants. Plant J. 28, 619631</ref>
 +
<ref name="ref4">Griffiths, S., Dunford, R.P., Coupland, G. and Laurie, D.A. (2003) The evolution of CONSTANS-like gene families in barley, rice, and Arabidopsis. Plant Physiol. 131, 1855–1867</ref>
 +
<ref name="ref5">Yano, M., Katayose, Y., Ashikari, M. et al. (2000) Hd1, a major photoperiod sensitivity quantitative trait locus in rice, is closely related to the Arabidopsis flowering time gene CONSTANS. Plant Cell, 12, 24732483</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os02g0610500|
 
Description = Similar to CONSTANS-like protein CO9 (Fragment)|
 
Version = NM_001053934.1 GI:115447238 GeneID:4329950|
 
Length = 1469 bp|
 
Definition = Oryza sativa Japonica Group Os02g0610500, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
 
AP = Chromosome 2:24847664..24849132|
 
CDS = 24847765..24848448,24848530..24848844|
 
GCID = <gbrowseImage1>
 
name=NC_008395:24847664..24849132
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008395:24847664..24849132
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggaggcggtggaggacaaggcgatggtgggagtgggaggagcggtggcggcggggtactcctcgtcgtcgtgggggttggggacgcgggcgtgcgactcgtgcggcggggaggcggcgcggctctactgccgcgcggacggggcgttcctgtgcgcccggtgcgacgcgcgggcgcacggcgccgggtcgcgccacgcgcgggtgtggctgtgcgaggtgtgcgagcacgcgcccgccgccgtcacgtgccgggcggacgccgcggcgctgtgcgccgcctgcgacgccgacatccactcggcgaacccgctcgcgcgcaggcacgagcgcctccccgtcgcgcccttcttcggcccgctcgccgacgcgccgcagcccttccccttctcccaggccgccgcggatgccgccgcggcgcgggaggaggatgcggatgatgaccggagcaacgaggccgaggcggcgtcgtggcttctccccgagcccgacgacaatagccacgaggatagcgccgcagccgccgacgcgttcttcgccgacaccggcgcgtacctcggcgtcgacctggacttcgcccggtccatggacggaatcaaggccatcggggtaccggtcgcgccgcccgagctggacctcaccgccggcagccttttctaccccgaacactccatggcccacagcttgtcgtcgtcggaggtcgcgatcgtaccggacgcgctgtcggcgggctcggcggcgccgcccatggtggtggtggtggcgagcaaggggaaggagagggaggcgcggctgatgcggtacagggagaagcgcaagaaccggcggttcgacaagaccatccggtacgcgtcccgcaaggcgtacgccgagacgcggccgcgcatcaagggccggttcgccaagcgcaccgccgacgccgacgacgacgacgaggcgccatgctcgccggcgttctccgccctcgccgcgtcggacggcgtcgtgccgtcgttctga</cdnaseq>|
 
AA = <aaseq>MEAVEDKAMVGVGGAVAAGYSSSSWGLGTRACDSCGGEAARLYC                    RADGAFLCARCDARAHGAGSRHARVWLCEVCEHAPAAVTCRADAAALCAACDADIHSA                    NPLARRHERLPVAPFFGPLADAPQPFPFSQAAADAAAAREEDADDDRSNEAEAASWLL                    PEPDDNSHEDSAAAADAFFADTGAYLGVDLDFARSMDGIKAIGVPVAPPELDLTAGSL                    FYPEHSMAHSLSSSEVAIVPDALSAGSAAPPMVVVVASKGKEREARLMRYREKRKNRR                    FDKTIRYASRKAYAETRPRIKGRFAKRTADADDDDEAPCSPAFSALAASDGVVPSF</aaseq>|
 
DNA = <dnaseqindica>102..785#867..1181#gtgcccaacgcccaaaaaacacagccaaactccgcgagaaaccgagctgcgagcgagtgaaacgcaccacgcgccgagcggcaaagcgaagcgaagaagaaatggaggcggtggaggacaaggcgatggtgggagtgggaggagcggtggcggcggggtactcctcgtcgtcgtgggggttggggacgcgggcgtgcgactcgtgcggcggggaggcggcgcggctctactgccgcgcggacggggcgttcctgtgcgcccggtgcgacgcgcgggcgcacggcgccgggtcgcgccacgcgcgggtgtggctgtgcgaggtgtgcgagcacgcgcccgccgccgtcacgtgccgggcggacgccgcggcgctgtgcgccgcctgcgacgccgacatccactcggcgaacccgctcgcgcgcaggcacgagcgcctccccgtcgcgcccttcttcggcccgctcgccgacgcgccgcagcccttccccttctcccaggccgccgcggatgccgccgcggcgcgggaggaggatgcggatgatgaccggagcaacgaggccgaggcggcgtcgtggcttctccccgagcccgacgacaatagccacgaggatagcgccgcagccgccgacgcgttcttcgccgacaccggcgcgtacctcggcgtcgacctggacttcgcccggtccatggacggaatcaaggccatcggggtaccggtcgcgccgcccgagctggacctcaccgccggcagccttttctaccccgaacactccatggcccacagcgtaagcctcactaccacacagctagctctcgtcgatgctcatggcgcggcgttatgacatggtttcctacgcgttccgcagttgtcgtcgtcggaggtcgcgatcgtaccggacgcgctgtcggcgggctcggcggcgccgcccatggtggtggtggtggcgagcaaggggaaggagagggaggcgcggctgatgcggtacagggagaagcgcaagaaccggcggttcgacaagaccatccggtacgcgtcccgcaaggcgtacgccgagacgcggccgcgcatcaagggccggttcgccaagcgcaccgccgacgccgacgacgacgacgaggcgccatgctcgccggcgttctccgccctcgccgcgtcggacggcgtcgtgccgtcgttctgaggaaggacgtacgcacggtacggcgagtcggcgacgtgcgccgtcgtaattttggcgcgccccgtgcgcgcgtgcatgcgtgcgtgtgtgcgacgcatggccccgtgtgacatgaataatatgtacagtagtttttcatccatggacgtagtattctattgtactccttgtactcctactactcctcttctgcctaaccaaggcttgtacattaccatgggagtagctgtttttgcaaccgtgaccatggttcagtgcttcaagttcaagggcgttaatgttactgtc</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001053934.1 RefSeq:Os02g0610500]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 03:18, 12 May 2017

Plants recognize environmental factors to determine flowering time. CONSTANS (CO) plays a central role in the photoperiod flowering pathway of Arabidopsis, and CO protein stability is modulated by photoreceptor.

Annotated Information

Gene Symbol

  • Os02g0610500 <=> OsBBX5, OsCCT06, OsCOL4, OsCOL4/OsD, OsD

function

Figure 1. Phenotypes of oscol4-1, oscol4-2, and WT at heading stage .(from reference)[1]).
  • OsCOL4 is a member of the CONSTANS-like (COL) family in rice.
  • OsCOL4 is a constitutive repressorfunctioning upstream of Ehd1 and functions independently from previously reported flowering pathways.

Phenotypic analysis

  • In osphyB mutants, OsCOL4 expression was decreased and osphyB oscol4 double mutants flowered at the same time as the osphyB single mutants,indicating OsCOL4 functions downstream of OsphyB.[1]

Expression

  • OsCOL4 null mutants flowered early under short or long days. In contrast, OsCOL4 activation-tagging mutants (OsCOL4-D) flowered late in either environment.
  • Transcripts of Ehd1, Hd3a, and RFT1 were increased in the oscol4 mutants, but reduced in the OsCOL4-D mutants.
  • By comparison, levels of Hd1, OsID1, OsMADS50, OsMADS51, and OsMADS56 transcripts were not significantly changed in oscol4 or OsCOL4-D.
  • In osphyB mutants, OsCOL4 expression was decreased and osphyB oscol4 double mutants flowered at the same time as the osphyB single mutants[1]

Evolution

  • Plants recognize environmental factors to determine flowering time. CONSTANS (CO) plays a central role in the photoperiod flowering pathway of Arabidopsis, and CO protein stability is modulated by photoreceptor[1]s.
  • In the former, GIGANTEA (GI) activates CONSTANS (CO), which promotes Flowering Locus T (FT) expression[2]. The CO gene is a member of a B-box transcription factor family which contains a CCT (CO, CO-like, and TOC1) domain at the C-terminal end[3] .
  • In rice, Hd1, an ortholog of CO, acts as a flowering promoter, and phytochromes repress Hd1 expression.The rice genome contains 16 OsCOL genes [4]. Among them, Hd1 was identified first via QTL analyses [5].
  • Two groups of rice COL proteins differ from those in Arabidopsis [4].

Labs working on this gene

  • Department of Life Science, Pohang University of Science and Technology (POSTECH), Pohang 790–784, Korea
  • Crop Biotech Institute, Kyung Hee University, Yongin 446–701, Korea
  • Department of Plant Systems Biotech, Kyung Hee University, Yongin 446–701, Korea
  • Gyeongsang National University, Korea
  • the Plant Functional Genomics Laboratory at the POSTECH

References

  1. 1.0 1.1 1.2 1.3 Yang-Seok Lee; Dong-Hoon Jeong; Dong-Yeon Lee;(2010)OsCOL4 is a constitutive flowering repressor upstream of Ehd1 and downstream of OsphyB The Plant Journal, 63(1): 18-30
  2. Yanovsky, M.J. and Kay, S.A. (2002) Molecular basis of seasonal time measurement in Arabidopsis. Nature, 419, 308–312
  3. Robson, F., Costa, M.M.R., Hepworth, S.R.. (2001) Functional importance of conserved domains in the flowering-time gene CONSTANS demonstrated by analysis of mutant alleles and transgenic plants. Plant J. 28, 619631
  4. 4.0 4.1 Griffiths, S., Dunford, R.P., Coupland, G. and Laurie, D.A. (2003) The evolution of CONSTANS-like gene families in barley, rice, and Arabidopsis. Plant Physiol. 131, 1855–1867
  5. Yano, M., Katayose, Y., Ashikari, M. et al. (2000) Hd1, a major photoperiod sensitivity quantitative trait locus in rice, is closely related to the Arabidopsis flowering time gene CONSTANS. Plant Cell, 12, 24732483

Structured Information