|
|
| (12 intermediate revisions by 3 users not shown) |
| Line 1: |
Line 1: |
| − | Please input one-sentence summary here.
| + | The rice Os05g0573500 was reported as '''''OsHAP3C''''' in 2003 by researchers from Japan,. |
| | | | |
| | ==Annotated Information== | | ==Annotated Information== |
| | + | [[File:Os01g0834400.png|right|thumb|427px|'''Figure 2.''' ''Figure 2. Expression patterns of OsHAP3 genes.<ref name="ref1" />.'']] |
| | + | ===Gene Symbol=== |
| | + | *'''''Os05g0573500''''' '''''<=>''''' '''''OsHAP3C,HAP3C''''' |
| | + | |
| | ===Function=== | | ===Function=== |
| − | Please input function information here.
| + | * '''''OsHAP3C''''' encode a HAP3/nuclear factor-YB (NF-YB)/CCAAT binding factor-A (CBF-A) subunit of a CCAAT-box binding complex in rice (Oryza sativa) |
| | + | * '''''OsHAP3C''''' genes regulate chloroplast biogenesis in rice. |
| | + | |
| | + | ===Phenotypic analysis=== |
| | + | * In the transgenic rice plants with antisense or RNAi construct of OsHAP3A, reduced expression of not only '''''OsHAP3A''''' but also '''''OsHAP3B''''' and '''''OsHAP3C''''' was observed. These plants had pale green leaves, in which the amount of chloro- phyll was reduced and chloroplasts were degenerated. |
| | + | * Lamella was not well developed and accumulation of starch was not detected. |
| | + | * The degenerated chloroplast formation was accompanied by reduced expression of nuclear-encoded photosynthesis genes such as RBCS and CAB, while expression of chloroplast-encoded genes was not affected or rather increased. |
| | | | |
| | ===Expression=== | | ===Expression=== |
| − | Please input expression information here.
| + | * '''''OsHAP3C''''' was expressed in various organs including leaves. |
| − | | |
| − | ===Evolution===
| |
| − | Please input evolution information here.
| |
| − | | |
| − | You can also add sub-section(s) at will.
| |
| | | | |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| − | Please input related labs here.
| + | 1.Plant Genetics Laboratory, National Institute of Genetics, 1111 Yata, Mishima, Shizuoka-ken 411-8540, Japan.<br> |
| | + | 2.Department of Life Science, Graduate University for Advanced Studies, 1111 Yata, Mishima, Shizuoka-ken 411-8540, Japan. |
| | | | |
| | ==References== | | ==References== |
| − | Please input cited references here.
| + | <references><ref name="ref1"> Kazumaru Miyoshi;Yukihiro Ito;Akiko Serizawa;Nori Kurata, OsHAP3 genes regulate chloroplast biogenesis in rice, The Plant Journal, 2003, 36(4): 532-540.</ref> |
| | + | </references> |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| |
| − | GeneName = Os05g0573500|
| |
| − | Description = HAP3|
| |
| − | Version = NM_001062918.1 GI:115465566 GeneID:4339676|
| |
| − | Length = 2697 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os05g0573500, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| | | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 5|Chromosome 5]]|
| |
| − | AP = Chromosome 5:28654041..28656737|
| |
| − | CDS = 28654226..28654428,28654585..28654714,28655594..28655599,28655680..28655757,28656441..28656455<br>|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008398:28654041..28656737
| |
| − | source=RiceChromosome05
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008398:28654041..28656737
| |
| − | source=RiceChromosome05
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atgtcggaggggttcgacgggacggagaacggcggcggcggcggcggaggcggagtagggaaggagcaggaccggttcctgccgatcgccaacatcggccgcatcatgcgccgggccgtgccggagaacggcaagatcgccaaggactccaaggagtccgtccaggagtgcgtctccgagttcatcagcttcatcaccagcgaagcaagcgacaagtgcctcaaggagaagcgcaagaccatcaatggggacgacctgatctggtcaatgggcacgctcggattcgaggactatgtcgagcctctcaagctctacctcaggctctaccgggagacggagggtgacacaaagggttcaagagcttctgaactgccagtaaagaaagatgttgtacttaatggagatcctggatcatcgtttgaaggcatgtag</cdnaseq>|
| |
| − | AA = <aaseq>MSEGFDGTENGGGGGGGGVGKEQDRFLPIANIGRIMRRAVPENG KIAKDSKESVQECVSEFISFITSEASDKCLKEKRKTINGDDLIWSMGTLGFEDYVEPL KLYLRLYRETEGDTKGSRASELPVKKDVVLNGDPGSSFEGM</aaseq>|
| |
| − | DNA = <dnaseqindica>186..388#545..674#1554..1559#1640..1717#2401..2415#gtcgagatccggcggccggtggcgtcctcctccctctccctcctccccaaccaacggcgctgatcccctccgccatctccgtccatctccgcctaaaaaaactaaggtaagccaccaactttcccttgacaccagcagtagtggtagtcgctctccttctcaccgacctctgccatggcccagcgatgtcggaggggttcgacgggacggagaacggcggcggcggcggcggaggcggagtagggaaggagcaggaccggttcctgccgatcgccaacatcggccgcatcatgcgccgggccgtgccggagaacggcaagatcgccaaggactccaaggagtccgtccaggagtgcgtctccgagttcatcagcttcatcaccagcgagtcagtgtcgcctcgcctttgtatttgctgtatatatcggtgccggagcttgcttgatccgatccagttcggagcggcggcggcgcattttgtcgtgcacctgccgtgcagatggcaagggtgactgacggccatctttggcatctttccctgcagagcaagcgacaagtgcctcaaggagaagcgcaagaccatcaatggggacgacctgatctggtcaatgggcacgctcggattcgaggactatgtcgagcctctcaagctctacctcaggctctaccgggaggtattgttcctctcctctctcttccagagtgtttcctagtattgtattgcctagtgatgcatatgttactacgtgggaagtgaaggctggttcacctcgattaggtaggcgtaggcttctatattcgcacacagtttgcctaagcttttgatacacagactgatgctcatacgagctctgcactgattggattgtgcatataccatgaggccatgattcgtgcaaaaggagagagctttcgtgattgtacttatatcaaggctttgacttagtattacttggtctgtcacatgggttgattcactccaaattgatggatggttgatttagttgccaacagtagattgcggaaaggttgaatgtgctgcctgaatgttaagcgcccaatatttctaggtccagggcatgcactgtaaaggtggaattttctttgtacttattggcatgaaccgattcaaaatggccgtagtcttccatctgtaggcgtgctgctggcagagtggccaggttaacatggactgtaattttgttttatgtccataaagctacatatctgatgaacgccaatgcaaacttgcaattgtcagattatgaactacatttatgctgaagacatgtaacatttttgctgaactgacattagtgcctggaccaagattgattttttttcatcagcatatatttttaatttcaatcactagtgagatataaaatacaacaaaaggatgtttcattgtcctccagaaaaagatatttaccgatataatttcctttgttttcttttccatattatacacaaatttttacgtgcactgatagttttttcccctttcttgcatgaataacaacggccgttgattacccttgatggtactgaagacggaggtatttcccatgttgtattacttgttaatctttaagttttgttaatgaaggtttattcaatttacttgttgatcttctagggtgacacaaagggttcaagagcttctgaactgccagtaaagaaagatgttgtacttaatggagatcctggatcatcggtaatatatagttccttgtgccaagttttaataaaacgaaacattgcactaccatctgcctttctttattgtcaagcacacattcacatatttttccctacaacttgctgtattatcttttttgcaagtgctacatcaatatgcacaaaactctcattgttttgaccattcttctattcatgccagtatgccactagctgatgcatcagcagcgtgaaaatgttaactgttttttttagtttctaagattatcgtttgggctgtaaacatattcataacctgttatttctgctgctgcattatgggtctgtgattttgttggagggctgtagtcaggctagcctttgactggttctggtataaaaatggattgaaaagccaaacataaagcctggttttgttttaaggtttcatggaagctggcttactttgtataaacttgttattttcaaaaatcaatcacttctagattgcacattgttgagccatgcattttctttccttttgcttttcaacctttaataccatttctgtatcatgatatatttgttccccttacttttggttttcctgctattcttgatcggtaaccattggtagccatattagtaatattgaaaagttatttttggatgaatataatggtgcaagcaaatctcactggagcattattttcttgacagtttgaaggcatgtaggacgaggagtgtgatagcatctaggaaggagaaccatcgtttttagggaaagaacgctccagcatcctgttatgttgtaagcaggatgcttctaaagttccaataccttgttaccacgaatgttagtcgtcgttctttttgaaatgttcttgtgttagccaggatgtccaaatttgttgtaggttctagttcagtcgtgtgttgtgtggttgtgtctaaccatatttggccgtttccggctgtcctgcatatgctaaattcagaggggtaaagagatctaag</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001062918.1 RefSeq:Os05g0573500]|
| |
| − | }}
| |
| | [[Category:Genes]] | | [[Category:Genes]] |
| | [[Category:Japonica mRNA]] | | [[Category:Japonica mRNA]] |
The rice Os05g0573500 was reported as OsHAP3C in 2003 by researchers from Japan,.
Annotated Information
Figure 2. Figure 2. Expression patterns of OsHAP3 genes.[1].
Gene Symbol
- Os05g0573500 <=> OsHAP3C,HAP3C
Function
- OsHAP3C encode a HAP3/nuclear factor-YB (NF-YB)/CCAAT binding factor-A (CBF-A) subunit of a CCAAT-box binding complex in rice (Oryza sativa)
- OsHAP3C genes regulate chloroplast biogenesis in rice.
Phenotypic analysis
- In the transgenic rice plants with antisense or RNAi construct of OsHAP3A, reduced expression of not only OsHAP3A but also OsHAP3B and OsHAP3C was observed. These plants had pale green leaves, in which the amount of chloro- phyll was reduced and chloroplasts were degenerated.
- Lamella was not well developed and accumulation of starch was not detected.
- The degenerated chloroplast formation was accompanied by reduced expression of nuclear-encoded photosynthesis genes such as RBCS and CAB, while expression of chloroplast-encoded genes was not affected or rather increased.
Expression
- OsHAP3C was expressed in various organs including leaves.
Labs working on this gene
1.Plant Genetics Laboratory, National Institute of Genetics, 1111 Yata, Mishima, Shizuoka-ken 411-8540, Japan.
2.Department of Life Science, Graduate University for Advanced Studies, 1111 Yata, Mishima, Shizuoka-ken 411-8540, Japan.
References
- ↑ Kazumaru Miyoshi;Yukihiro Ito;Akiko Serizawa;Nori Kurata, OsHAP3 genes regulate chloroplast biogenesis in rice, The Plant Journal, 2003, 36(4): 532-540.
Structured Information