Difference between revisions of "Os02g0134200"

From RiceWiki
Jump to: navigation, search
 
(4 intermediate revisions by 2 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os02g0134200''''' was reported as '''''OsSGL''''' in 2016 <ref name="ref1" /> by researchers from China .  
 +
 
  
 
==Annotated Information==
 
==Annotated Information==
 +
 +
===Gene Symbol===
 +
*'''''Os02g0134200''''' '''''<=>''''' '''''OsSGL,SGL'''''
 
===Function===
 
===Function===
Please input function information here.
+
*OsSGL may regulate stress-tolerance and cell growth by acting via a cytokinin signaling pathway.
 +
===Phenotypic analysis===
 +
*Overexpression of OsSGL significantly altered certain development processes greatly and positively affecting an array of traits in transgenic rice plants, including increased grain length, grain weight and grain number per panicle, resulting in a significant increase in yield.
 +
*enhanced OsSGL expression promoted cell division and grain filling
 +
*Microarray and quantitative real-time PCR(qRT-PCR) analyses revealed that a large number of genes involved in stress-response, cell cycle and cytokinin signaling processes were induced or suppressed in OsSGL-overexpressing plants.
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
*OsSGL encodes a putative member of the DUF1645 protein family of unknown function
  
===Evolution===
 
Please input evolution information here.
 
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
*Key Laboratory of Agro-ecological Processes in Subtropical Region, Institute of Subtropical Agriculture, Chinese Academy of Sciences, Changsha, Hunan 410125, China
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Wang M, Lu X, Xu G, Yin X, Cui Y, Huang L, Rocha PS, Xia X. OsSGL, a novel
 +
pleiotropic stress-related gene enhances grain length and yield in rice. Sci Rep.
 +
2016 Dec 5;6:38157. doi: 10.1038/srep38157. PubMed PMID: 27917884; PubMed Central
 +
PMCID: PMC5137154.
 +
</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]]
GeneName = Os02g0134200|
 
Description = Protein of unknown function DUF1645 family protein|
 
Version = NM_001052345.1 GI:115444060 GeneID:4328218|
 
Length = 1062 bp|
 
Definition = Oryza sativa Japonica Group Os02g0134200, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
 
AP = Chromosome 2:1799750..1800811|
 
CDS = 1799939..1800706|
 
GCID = <gbrowseImage1>
 
name=NC_008395:1799750..1800811
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008395:1799750..1800811
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atgccacccagcgccgccgccgcagccgcgatggcgcagtcgccgcgcagcctccacacgctgatcagcttcggccgcggcgccgacggcgtcgacgacgatgaggccacgcccgcgtcggtcgacgttggtgacgcggagggcgccgggctcgacctcgacttcgcgttcgcgccgccggtgtcggcggccgagctggcgccggccgacgacatcttcgcgcacggccgcatcgtgccggcgtacccggtgttcgaccgcagcctcctcgacctctcgcccggcgacgcctccacggcggcgccctccgccgacacctactgcgcgtggacgccgcgctcggcgccgggctcgcccggccgcgacaggttccccaagagcgcgtccaccggcggagagtcgtcgtcgtcatcgcggcgctggcgcctgcgcgacctcgtcggcgccggcggccgctcccgcagcgacggcaaggacaagttcgccttcctgcaccaccacgccgccgcgccgccatcatccaaactgaagactcctcctccccctcaacaaccacagcagaagaagcagagcgccgtgaagacgaagccggcggcgaagaagggcgtggtcaccgagatggacatggccaccgcgcacaggctcttctacagcaaggccagcgccggcggcgaccggcggccgcagcaagcctcgtacctgacgtaccgaccggcgttcagcggcctcttcgcgctcggccggtcgcaacaccacaccgcctattag</cdnaseq>|
 
AA = <aaseq>MPPSAAAAAAMAQSPRSLHTLISFGRGADGVDDDEATPASVDVG                    DAEGAGLDLDFAFAPPVSAAELAPADDIFAHGRIVPAYPVFDRSLLDLSPGDASTAAP                    SADTYCAWTPRSAPGSPGRDRFPKSASTGGESSSSSRRWRLRDLVGAGGRSRSDGKDK                    FAFLHHHAAAPPSSKLKTPPPPQQPQQKKQSAVKTKPAAKKGVVTEMDMATAHRLFYS                    KASAGGDRRPQQASYLTYRPAFSGLFALGRSQHHTAY</aaseq>|
 
DNA = <dnaseqindica>106..873#ctcacacaccacaccacaccaacatcgagcgcgtcgagtcgaatccaatccactccactccaccccgcgatctcctctcctctcgtctccggcgaagacgacgtgatgccacccagcgccgccgccgcagccgcgatggcgcagtcgccgcgcagcctccacacgctgatcagcttcggccgcggcgccgacggcgtcgacgacgatgaggccacgcccgcgtcggtcgacgttggtgacgcggagggcgccgggctcgacctcgacttcgcgttcgcgccgccggtgtcggcggccgagctggcgccggccgacgacatcttcgcgcacggccgcatcgtgccggcgtacccggtgttcgaccgcagcctcctcgacctctcgcccggcgacgcctccacggcggcgccctccgccgacacctactgcgcgtggacgccgcgctcggcgccgggctcgcccggccgcgacaggttccccaagagcgcgtccaccggcggagagtcgtcgtcgtcatcgcggcgctggcgcctgcgcgacctcgtcggcgccggcggccgctcccgcagcgacggcaaggacaagttcgccttcctgcaccaccacgccgccgcgccgccatcatccaaactgaagactcctcctccccctcaacaaccacagcagaagaagcagagcgccgtgaagacgaagccggcggcgaagaagggcgtggtcaccgagatggacatggccaccgcgcacaggctcttctacagcaaggccagcgccggcggcgaccggcggccgcagcaagcctcgtacctgacgtaccgaccggcgttcagcggcctcttcgcgctcggccggtcgcaacaccacaccgcctattagtttaatcacttggtcaataaccaaaccaactgattactagtggtagttgttgttaaattaattgttttgttgtaaaagtgttcaaaattttcggcgaaattcgagtcgagatttctcgtttgtactagaaccttatcatgtacataaatggaaaaagagaggaatgaaatttgagagatgattttgtct</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001052345.1 RefSeq:Os02g0134200]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 2]]
 
[[Category:Chromosome 2]]
 

Latest revision as of 07:18, 21 May 2017

The rice Os02g0134200 was reported as OsSGL in 2016 [1] by researchers from China .


Annotated Information

Gene Symbol

  • Os02g0134200 <=> OsSGL,SGL

Function

  • OsSGL may regulate stress-tolerance and cell growth by acting via a cytokinin signaling pathway.

Phenotypic analysis

  • Overexpression of OsSGL significantly altered certain development processes greatly and positively affecting an array of traits in transgenic rice plants, including increased grain length, grain weight and grain number per panicle, resulting in a significant increase in yield.
  • enhanced OsSGL expression promoted cell division and grain filling
  • Microarray and quantitative real-time PCR(qRT-PCR) analyses revealed that a large number of genes involved in stress-response, cell cycle and cytokinin signaling processes were induced or suppressed in OsSGL-overexpressing plants.

Expression

  • OsSGL encodes a putative member of the DUF1645 protein family of unknown function


You can also add sub-section(s) at will.

Labs working on this gene

  • Key Laboratory of Agro-ecological Processes in Subtropical Region, Institute of Subtropical Agriculture, Chinese Academy of Sciences, Changsha, Hunan 410125, China

References

  1. Wang M, Lu X, Xu G, Yin X, Cui Y, Huang L, Rocha PS, Xia X. OsSGL, a novel pleiotropic stress-related gene enhances grain length and yield in rice. Sci Rep. 2016 Dec 5;6:38157. doi: 10.1038/srep38157. PubMed PMID: 27917884; PubMed Central PMCID: PMC5137154.

Structured Information