Difference between revisions of "Os02g0134200"

From RiceWiki
Jump to: navigation, search
(Created page with "{{JaponicaGene| GeneName = Os02g0134200| Description = Protein of unknown function DUF1645 family protein| Version = NM_001052345.1 GI:115444060 GeneID:4328218| Length = 1...")
 
 
(5 intermediate revisions by 3 users not shown)
Line 1: Line 1:
{{JaponicaGene|
+
The rice '''''Os02g0134200''''' was reported as '''''OsSGL''''' in 2016 <ref name="ref1" /> by researchers from China .  
GeneName = Os02g0134200|
 
Description = Protein of unknown function DUF1645 family protein|
 
Version = NM_001052345.1 GI:115444060 GeneID:4328218|
 
Length = 1062 bp|
 
Definition = Oryza sativa Japonica Group Os02g0134200, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
+
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
+
==Annotated Information==
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
+
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
+
===Gene Symbol===
|
+
*'''''Os02g0134200''''' '''''<=>''''' '''''OsSGL,SGL'''''
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
+
===Function===
AP = Chromosome 2:1799750..1800811|
+
*OsSGL may regulate stress-tolerance and cell growth by acting via a cytokinin signaling pathway.
CDS = 1799939..1800706|
+
===Phenotypic analysis===
GCID = <gbrowseImage1>
+
*Overexpression of OsSGL significantly altered certain development processes greatly and positively affecting an array of traits in transgenic rice plants, including increased grain length, grain weight and grain number per panicle, resulting in a significant increase in yield.  
name=NC_008395:1799750..1800811
+
*enhanced OsSGL expression promoted cell division and grain filling
source=RiceChromosome02
+
*Microarray and quantitative real-time PCR(qRT-PCR) analyses revealed that a large number of genes involved in stress-response, cell cycle and cytokinin signaling processes were induced or suppressed in OsSGL-overexpressing plants.
preset=GeneLocation
+
 
</gbrowseImage1>|
+
===Expression===
GSID = <gbrowseImage2>
+
*OsSGL encodes a putative member of the DUF1645 protein family of unknown function
name=NC_008395:1799750..1800811
+
 
source=RiceChromosome02
+
 
preset=GeneLocation
+
You can also add sub-section(s) at will.
</gbrowseImage2>|
+
 
CDNA = <cdnaseq>atgccacccagcgccgccgccgcagccgcgatggcgcagtcgccgcgcagcctccacacgctgatcagcttcggccgcggcgccgacggcgtcgacgacgatgaggccacgcccgcgtcggtcgacgttggtgacgcggagggcgccgggctcgacctcgacttcgcgttcgcgccgccggtgtcggcggccgagctggcgccggccgacgacatcttcgcgcacggccgcatcgtgccggcgtacccggtgttcgaccgcagcctcctcgacctctcgcccggcgacgcctccacggcggcgccctccgccgacacctactgcgcgtggacgccgcgctcggcgccgggctcgcccggccgcgacaggttccccaagagcgcgtccaccggcggagagtcgtcgtcgtcatcgcggcgctggcgcctgcgcgacctcgtcggcgccggcggccgctcccgcagcgacggcaaggacaagttcgccttcctgcaccaccacgccgccgcgccgccatcatccaaactgaagactcctcctccccctcaacaaccacagcagaagaagcagagcgccgtgaagacgaagccggcggcgaagaagggcgtggtcaccgagatggacatggccaccgcgcacaggctcttctacagcaaggccagcgccggcggcgaccggcggccgcagcaagcctcgtacctgacgtaccgaccggcgttcagcggcctcttcgcgctcggccggtcgcaacaccacaccgcctattag</cdnaseq>|
+
==Labs working on this gene==
AA = <aaseq>MPPSAAAAAAMAQSPRSLHTLISFGRGADGVDDDEATPASVDVG                    DAEGAGLDLDFAFAPPVSAAELAPADDIFAHGRIVPAYPVFDRSLLDLSPGDASTAAP                    SADTYCAWTPRSAPGSPGRDRFPKSASTGGESSSSSRRWRLRDLVGAGGRSRSDGKDK                    FAFLHHHAAAPPSSKLKTPPPPQQPQQKKQSAVKTKPAAKKGVVTEMDMATAHRLFYS                    KASAGGDRRPQQASYLTYRPAFSGLFALGRSQHHTAY</aaseq>|
+
*Key Laboratory of Agro-ecological Processes in Subtropical Region, Institute of Subtropical Agriculture, Chinese Academy of Sciences, Changsha, Hunan 410125, China
DNA = <dnaseqindica>106..873#ctcacacaccacaccacaccaacatcgagcgcgtcgagtcgaatccaatccactccactccaccccgcgatctcctctcctctcgtctccggcgaagacgacgtgatgccacccagcgccgccgccgcagccgcgatggcgcagtcgccgcgcagcctccacacgctgatcagcttcggccgcggcgccgacggcgtcgacgacgatgaggccacgcccgcgtcggtcgacgttggtgacgcggagggcgccgggctcgacctcgacttcgcgttcgcgccgccggtgtcggcggccgagctggcgccggccgacgacatcttcgcgcacggccgcatcgtgccggcgtacccggtgttcgaccgcagcctcctcgacctctcgcccggcgacgcctccacggcggcgccctccgccgacacctactgcgcgtggacgccgcgctcggcgccgggctcgcccggccgcgacaggttccccaagagcgcgtccaccggcggagagtcgtcgtcgtcatcgcggcgctggcgcctgcgcgacctcgtcggcgccggcggccgctcccgcagcgacggcaaggacaagttcgccttcctgcaccaccacgccgccgcgccgccatcatccaaactgaagactcctcctccccctcaacaaccacagcagaagaagcagagcgccgtgaagacgaagccggcggcgaagaagggcgtggtcaccgagatggacatggccaccgcgcacaggctcttctacagcaaggccagcgccggcggcgaccggcggccgcagcaagcctcgtacctgacgtaccgaccggcgttcagcggcctcttcgcgctcggccggtcgcaacaccacaccgcctattagtttaatcacttggtcaataaccaaaccaactgattactagtggtagttgttgttaaattaattgttttgttgtaaaagtgttcaaaattttcggcgaaattcgagtcgagatttctcgtttgtactagaaccttatcatgtacataaatggaaaaagagaggaatgaaatttgagagatgattttgtct</dnaseqindica>|
+
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001052345.1 RefSeq:Os02g0134200]|
+
==References==
}}
+
<references>
[[Category:Genes]]
+
* <ref name="ref1">
[[Category:Japonica mRNA]]
+
Wang M, Lu X, Xu G, Yin X, Cui Y, Huang L, Rocha PS, Xia X. OsSGL, a novel
[[Category:Oryza Sativa Japonica Group]]
+
pleiotropic stress-related gene enhances grain length and yield in rice. Sci Rep.
[[Category:Japonica Genes]]
+
2016 Dec 5;6:38157. doi: 10.1038/srep38157. PubMed PMID: 27917884; PubMed Central
[[Category:Japonica Chromosome 2]]
+
PMCID: PMC5137154.
[[Category:Chromosome 2]]
+
</ref>
 +
</references>
 +
 
 +
==Structured Information==
 +
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]]

Latest revision as of 07:18, 21 May 2017

The rice Os02g0134200 was reported as OsSGL in 2016 [1] by researchers from China .


Annotated Information

Gene Symbol

  • Os02g0134200 <=> OsSGL,SGL

Function

  • OsSGL may regulate stress-tolerance and cell growth by acting via a cytokinin signaling pathway.

Phenotypic analysis

  • Overexpression of OsSGL significantly altered certain development processes greatly and positively affecting an array of traits in transgenic rice plants, including increased grain length, grain weight and grain number per panicle, resulting in a significant increase in yield.
  • enhanced OsSGL expression promoted cell division and grain filling
  • Microarray and quantitative real-time PCR(qRT-PCR) analyses revealed that a large number of genes involved in stress-response, cell cycle and cytokinin signaling processes were induced or suppressed in OsSGL-overexpressing plants.

Expression

  • OsSGL encodes a putative member of the DUF1645 protein family of unknown function


You can also add sub-section(s) at will.

Labs working on this gene

  • Key Laboratory of Agro-ecological Processes in Subtropical Region, Institute of Subtropical Agriculture, Chinese Academy of Sciences, Changsha, Hunan 410125, China

References

  1. Wang M, Lu X, Xu G, Yin X, Cui Y, Huang L, Rocha PS, Xia X. OsSGL, a novel pleiotropic stress-related gene enhances grain length and yield in rice. Sci Rep. 2016 Dec 5;6:38157. doi: 10.1038/srep38157. PubMed PMID: 27917884; PubMed Central PMCID: PMC5137154.

Structured Information