Difference between revisions of "Os02g0684400"

From RiceWiki
Jump to: navigation, search
 
(One intermediate revision by one other user not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os02g0684400''''' was reported as '''''OXS3''''' in 2006 <ref name="ref1" /> by researchers from China.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os02g0684400''''' '''''<=>''''' '''''OXS3'''''
 
===Function===
 
===Function===
Please input function information here.
+
*fragments derived from two rice OXS3 (OXIDATIVE STRESS 3) homologs indeed reduced Cd accumulation in rice grain as well as throughout the plant without affecting grain yield or the content of Mn, Fe, Zn, and Cu.
  
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
*Plant Gene Engineering Center, South China Botanical Garden, Chinese Academy of Science, 723 Xingke Road, Guangzhou 510650, China
 
+
*Institute of Rice Research, Anhui Academy of Agricultural Sciences, Hefei 230031, China
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Wang C, Guo W, Ye S, Wei P, Ow DW. Reduction of Cd in Rice through Expression
 +
of OXS3-like Gene Fragments. Mol Plant. 2016 Feb 1;9(2):301-4. doi:
 +
10.1016/j.molp.2015.09.006. Epub 2015 Sep 25. PubMed PMID: 26407527.
 +
</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]]
GeneName = Os02g0684400|
 
Description = Conserved hypothetical protein|
 
Version = NM_001054296.1 GI:115447962 GeneID:4330344|
 
Length = 873 bp|
 
Definition = Oryza sativa Japonica Group Os02g0684400, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
 
AP = Chromosome 2:28876387..28877259|
 
CDS = 28876573..28876888,28876998..28877209|
 
GCID = <gbrowseImage1>
 
name=NC_008395:28876387..28877259
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008395:28876387..28877259
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggacgcgtacgcgtggtgccggcgcggcggcgcggcggattgcgaggagcaggaggaggatatcgggtcgccgtccacgtcggcggggagctcggcgcggtcgtcggggtcgtcctcggagctcgccgacgacgcgagctcctcctcctcctccagctcggcggagcgccgcttcgagatgtccgacctcatgacgcagctcccgttcaagagggggttgtcgaggttcttcgacggaaagtcgcagtcgttcgcgtcgctggcggcggtcgcctcgctggaggacctggcgaagccgccgaggaagcgcctcaagccgtcgcagagctgcgggggaggcctggacgcgcaccgcgggcgcgtcctgtcgccgcgccggcattgccccaaggccgtcgtcgccggcgccaagaaggcgaccgcgagggccgccctctcgatgctcgccgcctcgccgaggcggccgccgctggccgcgccggcgaggccggagggggtggcagctaagtttctcgtcgttaactag</cdnaseq>|
 
AA = <aaseq>MDAYAWCRRGGAADCEEQEEDIGSPSTSAGSSARSSGSSSELAD                    DASSSSSSSSAERRFEMSDLMTQLPFKRGLSRFFDGKSQSFASLAAVASLEDLAKPPR                    KRLKPSQSCGGGLDAHRGRVLSPRRHCPKAVVAGAKKATARAALSMLAASPRRPPLAA                    PARPEGVAAKFLVVN</aaseq>|
 
DNA = <dnaseqindica>372..687#51..262#gatctgagatcggcgttggtcggggagagtcaagagttggggatatatacatggacgcgtacgcgtggtgccggcgcggcggcgcggcggattgcgaggagcaggaggaggatatcgggtcgccgtccacgtcggcggggagctcggcgcggtcgtcggggtcgtcctcggagctcgccgacgacgcgagctcctcctcctcctccagctcggcggagcgccgcttcgagatgtccgacctcatgacgcagctcccgttcaagtgcgtgccgtttgctctagctggtcgcgttcttcttgatctttgatgatccttgagctagctgagctgacaccggagtgtttttttttttcatttttttcgtttgcaggagggggttgtcgaggttcttcgacggaaagtcgcagtcgttcgcgtcgctggcggcggtcgcctcgctggaggacctggcgaagccgccgaggaagcgcctcaagccgtcgcagagctgcgggggaggcctggacgcgcaccgcgggcgcgtcctgtcgccgcgccggcattgccccaaggccgtcgtcgccggcgccaagaaggcgaccgcgagggccgccctctcgatgctcgccgcctcgccgaggcggccgccgctggccgcgccggcgaggccggagggggtggcagctaagtttctcgtcgttaactaggtagtagaaagtttggtgatagttgcagtcgaagcaacgtgtttacccgtctgtacataagtactctgaatgaccggcattttcgctgtttggtggtccatttccactgtccgtggtaatttgttgggtgagcttgttgtaacataaatccacgattgatgaggtggatagttagaatgctcaatt</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001054296.1 RefSeq:Os02g0684400]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 2]]
 
[[Category:Chromosome 2]]
 

Latest revision as of 07:50, 21 May 2017

The rice Os02g0684400 was reported as OXS3 in 2006 [1] by researchers from China.

Annotated Information

Gene Symbol

  • Os02g0684400 <=> OXS3

Function

  • fragments derived from two rice OXS3 (OXIDATIVE STRESS 3) homologs indeed reduced Cd accumulation in rice grain as well as throughout the plant without affecting grain yield or the content of Mn, Fe, Zn, and Cu.


You can also add sub-section(s) at will.

Labs working on this gene

  • Plant Gene Engineering Center, South China Botanical Garden, Chinese Academy of Science, 723 Xingke Road, Guangzhou 510650, China
  • Institute of Rice Research, Anhui Academy of Agricultural Sciences, Hefei 230031, China

References

  1. Wang C, Guo W, Ye S, Wei P, Ow DW. Reduction of Cd in Rice through Expression of OXS3-like Gene Fragments. Mol Plant. 2016 Feb 1;9(2):301-4. doi: 10.1016/j.molp.2015.09.006. Epub 2015 Sep 25. PubMed PMID: 26407527.

Structured Information