Difference between revisions of "Os07g0657100"

From RiceWiki
Jump to: navigation, search
(Created page with "{{JaponicaGene| GeneName = Os07g0657100| Description = Glyoxalase/extradiol ring-cleavage dioxygenase domain containing protein| Version = NM_001067044.1 GI:115473820 GeneI...")
 
(Gene Symbol)
 
(3 intermediate revisions by 3 users not shown)
Line 1: Line 1:
{{JaponicaGene|
+
The rice '''''Os07g0657100''''' was reported as '''''OsGly''''' in 2016 <ref name="ref1" /> by researchers from China.  
GeneName = Os07g0657100|
 
Description = Glyoxalase/extradiol ring-cleavage dioxygenase domain containing protein|
 
Version = NM_001067044.1 GI:115473820 GeneID:4344153|
 
Length = 1059 bp|
 
Definition = Oryza sativa Japonica Group Os07g0657100, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
+
==Annotated Information==
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
+
===Gene Symbol===
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
+
*'''''Os07g0657100''''' '''''<=>''''' '''''OsEnS-113''''' '''''OsGLYI10'''''
            clade; Ehrhartoideae; Oryzeae; Oryza.
+
 
|
+
===Function===
Chromosome = [[:category:Japonica Chromosome 7|Chromosome 7]]|
+
*Glyoxalase I (Gly I) is a component of the glyoxalase system which is involved in the detoxification of methylglyoxal, a byproduct of glycolysis.
AP = Chromosome 7:28313181..28314239|
+
 
CDS = 28313342..28313596,28313749..28313860,28313953..28314215|
+
===Expression===
GCID = <gbrowseImage1>
+
*rice Gly I (OsGly I) was ubiquitously expressed in root, stem, leaf, leaf sheath and spikelet with varying abundance.
name=NC_008400:28313181..28314239
+
===Phenotypic analysis===
source=RiceChromosome07
+
*OsGly I was markedly upregulated in response to NaCl, ZnCl2 and mannitol in rice seedlings.
preset=GeneLocation
+
*The OsGly I-overexpression transgenic plants performed higher seed setting rate and yield.
</gbrowseImage1>|
+
 
GSID = <gbrowseImage2>
+
 
name=NC_008400:28313181..28314239
+
You can also add sub-section(s) at will.
source=RiceChromosome07
+
 
preset=GeneLocation
+
==Labs working on this gene==
</gbrowseImage2>|
+
*College of Life Science, Chongqing University, Chongqing 400030, China
CDNA = <cdnaseq>atgggggaagtgtgcaagcgagtggcgccgagcgtgcgggaggaggaggaggaggaggagaatggcgacggcggcggcgtcgacccggcagcggagtcgtcgtcggcgaagctgtacgaggacgtgccggagatgccgctgatggcgctgaaccacatctcccgcctctgcaagtccatcgacgcctccgtccgcttctacgtcaaggccctcggcttcgtcctcatccaccgccctcccgctctcgacttcaacggcgcctggcttttcaactacggagttgggatccatctcgtccagagagacgacgcgaggagagcgcccgacgtcaaccccggggacctcgaccccatggacaaccacatctccttccaatgcgaggacatggggatgatggagaagaggctgaacgagatggggatcgagtacatgaagcggaccatcaacgaggaggagggctcgcccatcgaccagctcttcttcaaggaccccgacggcttcatgatcgagatctgcaactgcgagaacctcgagctcgtccccgctggcgccctcggccgcctcaggctgccccgagaccgccacaacccgccgctccggatggccgccgccggcaacgacgaggcgtga</cdnaseq>|
+
*Key Laboratory of Southwest Rice Biology and Genetic Breeding, Sichuan Academy of Agricultural Sciences, Rice and Sorghum Research Institute, Luzhou Branch of National Rice Improvement Center, Ministry of Agriculture, Deyang 618000, China
AA = <aaseq>MGEVCKRVAPSVREEEEEEENGDGGGVDPAAESSSAKLYEDVPE                    MPLMALNHISRLCKSIDASVRFYVKALGFVLIHRPPALDFNGAWLFNYGVGIHLVQRD                    DARRAPDVNPGDLDPMDNHISFQCEDMGMMEKRLNEMGIEYMKRTINEEEGSPIDQLF                    FKDPDGFMIEICNCENLELVPAGALGRLRLPRDRHNPPLRMAAAGNDEA</aaseq>|
+
*School of Food Science and Engineering, Hefei University of Technology, Hefei 230009, China
DNA = <dnaseqindica>644..898#380..491#25..287#ggctgccggcgaccgacgaccgagatgggggaagtgtgcaagcgagtggcgccgagcgtgcgggaggaggaggaggaggaggagaatggcgacggcggcggcgtcgacccggcagcggagtcgtcgtcggcgaagctgtacgaggacgtgccggagatgccgctgatggcgctgaaccacatctcccgcctctgcaagtccatcgacgcctccgtccgcttctacgtcaaggccctcggcttcgtcctcatccaccgccctcccgctctcgacttcaacggcgcctggtaatcgtcaaaactccattactcaactctcgtacgtgcactgcacggtgcacgcgcgtaatcttacaggcatccatcgatcgatgctataggcttttcaactacggagttgggatccatctcgtccagagagacgacgcgaggagagcgcccgacgtcaaccccggggacctcgaccccatggacaaccacatctccttccaagtacgtacgttcgtacacatttctaacagcacgatgcaggtattgtaccatgcttgcacgaattaatgtgacagctgcgagatcgatcgaatcggtggttgtgtgtgcatcactacgaattaattaatgccaaaacctatttttgcatgcagtgcgaggacatggggatgatggagaagaggctgaacgagatggggatcgagtacatgaagcggaccatcaacgaggaggagggctcgcccatcgaccagctcttcttcaaggaccccgacggcttcatgatcgagatctgcaactgcgagaacctcgagctcgtccccgctggcgccctcggccgcctcaggctgccccgagaccgccacaacccgccgctccggatggccgccgccggcaacgacgaggcgtgagaaaaacgtacatccaagtgtacgtagttagtaaaattaagtagctgtcaggtctgagtacgcgaggttggctggttgaccggccggcccggcgaaatttcggttagctggttgcgtcgttgcaagcttgagtttgcgtatgctattactttcgttcgttg</dnaseqindica>|
+
*Ministry of Education Key Laboratory for Bio-resource and Eco-environment, College of Life Science, State Key Laboratory of Hydraulics and Mountain River Engineering, Sichuan University, Chengdu 610064, China
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001067044.1 RefSeq:Os07g0657100]|
+
 
}}
+
==References==
[[Category:Genes]]
+
<references>
[[Category:Japonica mRNA]]
+
* <ref name="ref1">
[[Category:Oryza Sativa Japonica Group]]
+
Zeng Z, Xiong F, Yu X, Gong X, Luo J, Jiang Y, Kuang H, Gao B, Niu X, Liu Y. Overexpression of a glyoxalase gene, OsGly I, improves abiotic stress tolerance and grain yield in rice (Oryza sativa L.). Plant Physiol Biochem. 2016 Dec;109:62-71. doi: 10.1016/j.plaphy.2016.09.006. Epub 2016 Sep 13. PubMed PMID: 27639962.
[[Category:Japonica Genes]]
+
</ref>
[[Category:Japonica Chromosome 7]]
+
</references>
[[Category:Chromosome 7]]
+
 
 +
 
 +
==Structured Information==
 +
[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 7]]

Latest revision as of 02:56, 22 May 2017

The rice Os07g0657100 was reported as OsGly in 2016 [1] by researchers from China.

Annotated Information

Gene Symbol

  • Os07g0657100 <=> OsEnS-113 OsGLYI10

Function

  • Glyoxalase I (Gly I) is a component of the glyoxalase system which is involved in the detoxification of methylglyoxal, a byproduct of glycolysis.

Expression

  • rice Gly I (OsGly I) was ubiquitously expressed in root, stem, leaf, leaf sheath and spikelet with varying abundance.

Phenotypic analysis

  • OsGly I was markedly upregulated in response to NaCl, ZnCl2 and mannitol in rice seedlings.
  • The OsGly I-overexpression transgenic plants performed higher seed setting rate and yield.


You can also add sub-section(s) at will.

Labs working on this gene

  • College of Life Science, Chongqing University, Chongqing 400030, China
  • Key Laboratory of Southwest Rice Biology and Genetic Breeding, Sichuan Academy of Agricultural Sciences, Rice and Sorghum Research Institute, Luzhou Branch of National Rice Improvement Center, Ministry of Agriculture, Deyang 618000, China
  • School of Food Science and Engineering, Hefei University of Technology, Hefei 230009, China
  • Ministry of Education Key Laboratory for Bio-resource and Eco-environment, College of Life Science, State Key Laboratory of Hydraulics and Mountain River Engineering, Sichuan University, Chengdu 610064, China

References

  1. Zeng Z, Xiong F, Yu X, Gong X, Luo J, Jiang Y, Kuang H, Gao B, Niu X, Liu Y. Overexpression of a glyoxalase gene, OsGly I, improves abiotic stress tolerance and grain yield in rice (Oryza sativa L.). Plant Physiol Biochem. 2016 Dec;109:62-71. doi: 10.1016/j.plaphy.2016.09.006. Epub 2016 Sep 13. PubMed PMID: 27639962.


Structured Information