|
|
| (4 intermediate revisions by 3 users not shown) |
| Line 1: |
Line 1: |
| − | Please input one-sentence summary here.
| + | The rice '''''Os02g0766700''''' was reported as '''''OsbZIP23''''' in 2016 <ref name="ref1" /> by researchers from India. |
| | | | |
| | ==Annotated Information== | | ==Annotated Information== |
| | + | ===Gene Symbol=== |
| | + | *'''''Os02g0766700''''' '''''<=>''''' '''''OsbZIP23''''' '''''bZIP23''''' |
| | ===Function=== | | ===Function=== |
| − | The basic leucine zipper (bZIP) transcription factors form a large gene family that is important in pathogen defense, light and stress signaling, etc.【1】Expression of OsbZIP23
| + | *'''''OsbZIP23''''' is a positive transcriptional-regulator of the ABA-signaling pathway. |
| − | is strongly induced by a wide spectrum of stresses, including drought, salt, abscisic acid (ABA), and polyethylene glycol treatments, while other stress-responsive genes of this family are slightly induced only by one or two of the stresses. Transactivation assay in yeast demonstrated that OsbZIP23 functions as a transcriptional activator, and the sequences at the N terminus (amino acids 1–59) and a region close to the C terminus (amino acids 210–240) are required for the transactivation activity. Transient expression of OsbZIP23-green fluorescent protein in onion (Allium cepa) cells revealed a nuclear localization of the protein. Transgenic rice overexpressing OsbZIP23 showed significantly improved tolerance to drought and high-salinity stresses and sensitivity to ABA. On the other hand, a null mutant of this gene showed significantly decreased sensitivity to a high concentration of ABA and decreased tolerance to high-salinity and drought stress, and this phenotype can be complemented by transforming the OsbZIP23 back into the mutant. GeneChip and real-time polymerase chain reaction analyses revealed that hundreds of genes were up- or down-regulated in the rice plants overexpressing OsbZIP23. More than half of these genes have been annotated or evidenced for their diverse functions in stress response or tolerance. In addition, more than 30 genes that are possible OsbZIP23-specific target genes were identified based on the comparison of the expression profiles in the overexpressor and the mutant of OsbZIP23. Collectively, these results indicate that OsbZIP23 functions as a transcriptional regulator that can regulate the expression of a wide spectrum of stress-related genes in response to abiotic stresses through an ABA-dependent regulation pathway. OsbZIP23 is a major player of the bZIP family in rice for conferring ABA-dependent drought and salinity tolerance and has high potential usefulness in genetic improvement of stress tolerance.【2】
| + | *Enhanced gene expression rather than natural polymorphism in coding sequence of '''''OsbZIP23''''' is accountable for improved drought tolerance and yield performance in rice genotypes. |
| | + | |
| | + | ===Phenotypic analysis=== |
| | + | *Analyses of the coding DNA sequence (CDS) of the cloned '''''OsbZIP23''''' gene revealed single nucleotide polymorphism at four places and a 15-nucleotide deletion at one place. |
| | + | *The overexpression of any of the two polymorphic forms(1083 bp and 1068 bp CDS) of '''''OsbZIP23''''' improved drought tolerance and yield-related traits significantly by retaining higher content of cellular water, soluble sugar and proline; and exhibited decrease in membrane lipid peroxidation in comparison to RNAi lines and non-transgenic plants. |
| | + | |
| | ===Expression=== | | ===Expression=== |
| − | In RNA gel-blot analysis,the transcript level of OsbZIP23 was rapidly and strongly induced by drought, high-salinity, polyethylene glycol (PEG), and ABA treatment but remained unchanged after low-temperature treatment (Fig. 2A),which agrees with the microarray data very well.The results suggested it was relatively higher in seedling and flag leaves than in other tissues checked (Fig.2C).
| + | *The single-copy '''''OsbZIP23''''' gene is expressed at relatively higher level in leaf tissues of drought-tolerant genotypes, and its abundance is more in reproductive stage. |
| | | | |
| | ===Evolution=== | | ===Evolution=== |
| − | Please input evolution information here.
| + | |
| | | | |
| | You can also add sub-section(s) at will. | | You can also add sub-section(s) at will. |
| | | | |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| − | Please input related labs here.
| + | *Adv. Lab. for Plant Genetic Engineering, Advanced Technology Development Center, Indian Institute of Technology Kharagpur, Kharagpur 721302, India |
| | + | *Department of Biotechnology, Indian Institute of Technology Kharagpur, Kharagpur 721302, India |
| | | | |
| | ==References== | | ==References== |
| − | 1. Qian Ji;Liang-sheng Zhang;Yi-fei Wang;Jian Wang
| + | <references> |
| − | Genome-wide analysis of basic leucine zipper transcription factor families in Arabidopsis thaliana, Oryza sativa and Populus trichocarpa
| + | * <ref name="ref1"> |
| − | Journal of Shanghai University (English Edition), 2009, 13(2): 174-182
| + | Dey A, Samanta MK, Gayen S, Sen SK, Maiti MK. Enhanced Gene Expression Rather than Natural Polymorphism in Coding Sequence of the OsbZIP23 Determines Drought Tolerance and Yield Improvement in Rice Genotypes. PLoS One. 2016 Mar 9;11(3):e0150763. doi: 10.1371/journal.pone.0150763. eCollection 2016. PubMed PMID: 26959651; PubMed Central PMCID: PMC4784890. |
| − | 2. Yong Xiang;Ning Tang;Hao Du;Haiyan Ye;Lizhong Xiong
| + | </ref> |
| − | Characterization of OsbZIP23 as a Key Player of the Basic Leucine Zipper Transcription Factor Family for Conferring Abscisic Acid Sensitivity and Salinity and Drought Tolerance in Rice
| + | </references> |
| − | Plant Physiology, 2008, 148(4): 1938-1952
| |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| + | [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]] |
| − | GeneName = Os02g0766700|
| |
| − | Description = Similar to Abscisic acid responsive elements-binding factor (ABA-responsive element binding protein 2) (AREB2)|
| |
| − | Version = NM_001054760.1 GI:115448890 GeneID:4330838|
| |
| − | Length = 4919 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os02g0766700, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| − | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
| |
| − | AP = Chromosome 2:33163523..33168441|
| |
| − | CDS = 33164060..33164140,33165696..33165725,33166800..33166871,33167335..33168225|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008395:33163523..33168441
| |
| − | source=RiceChromosome02
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008395:33163523..33168441
| |
| − | source=RiceChromosome02
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atggattttccgggagggagcgggaggcagcagcagctgccgccgatgacgccgctgccgttggcgaggcaggggtcggtgtactcgctcacgttcgacgagttccagagcacgctgggcggggtcgggaaggacttcgggtcgatgaacatggacgagctcctccgcagcatctggacggccgaggagtcgcacgccgtcggcgccgccacgacgacgacggcgacgacggcgtccgtggcggcggcggagcacgcggcggtgggggcgccgcccgttcagaggcaggggtcgctgaccctcccccgcacgctcagccagaagaccgtcgacgaggtctggcgcgacatgatgtgcttcggtggcggcggcgcctccaccgcgccggccgccgcggagcccccgccgccggcgcaccggcagcagacgctcggggagatcacgctggaggagttcctcgtgcgggccggcgtggtgagggaggacatgtcggtcccgcccgtcccgccggcgccgactcctacggcggctgctgtacctcccccgccgccgccgcagcagcagacgccgatgttgttcggtcagagcaatgtgttccctccgatggtgcctccgctctcgctgggaaatgggctggtctcgggagctgtcggacacggcggtggtggtgccgcgtcgttggtttcgccggtgaggccggtctcgtccaatggcttcggcaagatggaaggcggggacctgtcgtcgctgtcgccatcgccggtgccgtacgttttcaaaggtgggctgaggggaaggaaggcaccgggcatcgagaaggttgtcgagagaagacagcggcggatgatcaagaacagggagtctgccgcgaggtcgcgccagaggaaacaggcatatatgatggaattggaagctgaggtagcaaaacttaaggagctgaacgatgaactccagaaaaagcaggatgaaatgttggagcagcaaaagaatgaggttctagagagaatgagccgacaagttggaccgacagcaaagagaatttgccttcggaggactctgacgggtccatggtga</cdnaseq>|
| |
| − | AA = <aaseq>MDFPGGSGRQQQLPPMTPLPLARQGSVYSLTFDEFQSTLGGVGK DFGSMNMDELLRSIWTAEESHAVGAATTTTATTASVAAAEHAAVGAPPVQRQGSLTLP RTLSQKTVDEVWRDMMCFGGGGASTAPAAAEPPPPAHRQQTLGEITLEEFLVRAGVVR EDMSVPPVPPAPTPTAAAVPPPPPPQQQTPMLFGQSNVFPPMVPPLSLGNGLVSGAVG HGGGGAASLVSPVRPVSSNGFGKMEGGDLSSLSPSPVPYVFKGGLRGRKAPGIEKVVE RRQRRMIKNRESAARSRQRKQAYMMELEAEVAKLKELNDELQKKQDEMLEQQKNEVLE RMSRQVGPTAKRICLRRTLTGPW</aaseq>|
| |
| − | DNA = <dnaseqindica>4302..4382#2717..2746#1571..1642#217..1107#gtccggtttcctctcctcgcctcgccgcggcgcccgcgtcctcctcaccaacgccagagctccacatcccacctctcctcaggttcccgtctctgatccctcgttgcgttacggggaagcaggcgtggtggttgctccccgtgcggagttttcgattggtttggttgggtgagtttggtgctggggtgttggggattggttggttggagtttggagatggattttccgggagggagcgggaggcagcagcagctgccgccgatgacgccgctgccgttggcgaggcaggggtcggtgtactcgctcacgttcgacgagttccagagcacgctgggcggggtcgggaaggacttcgggtcgatgaacatggacgagctcctccgcagcatctggacggccgaggagtcgcacgccgtcggcgccgccacgacgacgacggcgacgacggcgtccgtggcggcggcggagcacgcggcggtgggggcgccgcccgttcagaggcaggggtcgctgaccctcccccgcacgctcagccagaagaccgtcgacgaggtctggcgcgacatgatgtgcttcggtggcggcggcgcctccaccgcgccggccgccgcggagcccccgccgccggcgcaccggcagcagacgctcggggagatcacgctggaggagttcctcgtgcgggccggcgtggtgagggaggacatgtcggtcccgcccgtcccgccggcgccgactcctacggcggctgctgtacctcccccgccgccgccgcagcagcagacgccgatgttgttcggtcagagcaatgtgttccctccgatggtgcctccgctctcgctgggaaatgggctggtctcgggagctgtcggacacggcggtggtggtgccgcgtcgttggtttcgccggtgaggccggtctcgtccaatggcttcggcaagatggaaggcggggacctgtcgtcgctgtcgccatcgccggtgccgtacgttttcaaaggtgggctgaggggaaggaaggcaccgggcatcgagaaggttgtcgagagaagacagcggcggatgatcaagaacagggagtctgccgcgaggtcgcgccagaggaaacaggtgaaaagtcctttttgttgcaacttgcaactgtttagcatttacttgtcgaattgccttgccttctagtacttgcctgtagtgacatgtgtagcacatatattttcccttttaagcatttcttttcttttcgatgcgacaactaacaaatagtaataaccgtgagaaatgtttatcatcatgctgatcgttttatttgctaactaggatatgtgcctcatatttgcaaagtttatgctgtatttggttcaaacatactgaaatttaattagtataaacgctataaacatatcttttgcacgtattaagcctagcctaaaattagtatacacgctataaacataaaacaaagtggtgtttataaaacataagcatatctttctccttgctaagttgctattgatgttctaaaactttttgtcattttttatggatttaatttgtgcttcctgatatggagcaggcatatatgatggaattggaagctgaggtagcaaaacttaaggagctgaacgatgaactccagaaaaagcaggtactctccatgttctgtttacatttctagtttgagttttgttcgttataatttggaaatacttcttcatgagttgaagtacgtagtacactttggtaatctttaaactttcaaacatatggaattccaatgaagcatttgatgctggcatattattcatttgcctgtgaactgccactctttagattggggatttgatgatacgccattgatttcagagggacccttgtgtcactgtcacatggtggcaagttgctaatcatcaaactaaaaaaattgctgttttgaaatcttaaactatcagtttttgttattctcaattgtcactagtttgccacatgtccacttagtttctagcagtagtctccagagcatttgaccaagtgaggtccttaccaatagaaatattataggtgttttcatatacttcctccatccttaaaagagtatctttttagctatgaacatagacaataccactcttttagtgacagaagttgtattgacgctatactctagtgtagccccttactttatagtctactcttgaaattggaaactaattctaaactgacaagttaccatgaaatatgttccacgcttgaaagttagttctaaacaaaactgaaggcatggtagagtaatcaaagtcggttccattttaaactgtttaaatagtttggtggtggactgctggttagttgcttgccttctttgtacaggatatttcattttataaattgtaatatacgtagcttatcatgcatcttaattgcaagtctaactaaaatagtacttatgaatgttgcattgcacccacacccacaattgtgattatttcattttgcactgtcttattacattctttgaggtttgcccttgttttgtccgcctttcatggtaagtacttctgagaaggaaaacaaaagaaaggctttacatgattcaaacataagtgccttaagacctgacaattctattcccttaggatagtggactagtaggcagtagctactctattcatttgattatgctttagcatttgaacttatttttatgtattctaatgtgcaggatgaaatgttggagcagcaaaagaatgaggtaattgcttatcttggaaaaaaaatcttttgctctggataggtactatgttttgcttattaatgtcaaacaagaaacaaaacgaagctgtgcaacctaggcatgctctgttttactgatagcttacttgtttaccaaaaagttttactctgtaaaatctgatagttttaccctttacatgagtattacagcctaatctgtcaatatcatacatatgctctgctctatgattatttttcgctcgtaatgtatggtgtgaattttaacaattattgttaggaaaatgtatgctgtgtatattaacaattattgattcacttgtttgaatgtcaaacgttatgttctgattgatagctactggtcgtgagttttggctttcacactattaccttatagtatgggattttaagcaatgatgaagtaaagctttgtggggggttgagaaataatgaggcaaggactgatgtcgatgtgattgattgcattttcctacatcaggggttaggtggcagcatttaaatggcttaaactaaaaaagaaattctttgaattgatcagtcaactgccatcattgttgaattataaccatttaaatgatatttcatctataataatacagttttaactaaatgcaacattggaagggcaagcaaatattaaagtttattcaaaaaacagttatttgatgtgtgtatagtttaatgcctatgtttccatcgtagtggggtataactgtattttccacaacataacacttaaaaaagttatgacaggatagacaattgtgaaactgtcaatattgtttgttacaatcaatttaactgacaattttgactgaactttacatgaagttaacacatctctcaacactgtaaaatctgtggatacctccttaggccaatcgttgtaaactctgctgagaagactgactgttctctgtaaaaagggatatgttctcataacactgaggcggcagaatttcaaaccgcactccctccatgtcctagttgtttttccacatcttagaccactagtttgaatgtgtacagaagctaagggagtgccacaaatggtttgaaacttagaatcatcagttttttagaggctactctaaccctgaaaaaatgtggattggacaaaaactgaattactgaatgcttgctctaactaatactggtatgtagcacacatacttggtatttctatttctgagaaagagcctcttgtagactcttgccacttctactcgacataattgtattttggtaaaaaggaaaacaatggagcctctgatgttatcataaactgtacaattcatttttgaaaaagcaaatcaccactcaattctatttaatttatgttgtcctttggttgggttttaatgacttcaaaatggggttccttatttttctgtcagcatactatctgacaattgttcctggtaaatttgggagagaagtttccaagcttttcgtttcctagtttgagattttcctctggcttcaagacaccaccgcgtaaaagtctaataatgcactgttaatggtttctgcaggttctagagagaatgagccgacaagttggaccgacagcaaagagaatttgccttcggaggactctgacgggtccatggtgatcgaagctaaaggcctagttacctgtaactagaacacagtcctttcaatgtgagcagtgatcatagtagttgtaggatggtgaagctgaagacctggttacctgtaactagaacacagtcctttcaaagtgagcagtgattacagtagtagtaggatggtgaagctgccagttacctgtaactagaacacagtcctttcaaagtgagtatagtagtaggttagttcagaatcgccagatcgatctgcccttgtaggccaaccattagtccgtgggcttgtctcttgggcggacaggctgcctgagatattcactcgataggttttagttgtctgagttatatccaagcattgtatgtaacctatttaaccatggtgcctgctacctgtattgtattttgctgctgtaggaacctatgtcggtgttaccatcttgttcttaatttgtgtacttctcttgccattttggataagatgtatctgaacttatacatatgtacttttccttgccattttggacaagatgtatctgaatttac</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001054760.1 RefSeq:Os02g0766700]|
| |
| − | }}
| |
| − | [[Category:Genes]] | |
| − | [[Category:Japonica mRNA]]
| |
| − | [[Category:Oryza Sativa Japonica Group]] | |
| − | [[Category:Japonica Genes]] | |
| − | [[Category:Japonica Chromosome 2]]
| |
| − | [[Category:Chromosome 2]]
| |