Difference between revisions of "Os02g0543000"

From RiceWiki
Jump to: navigation, search
(Phenotypic analysis)
 
(5 intermediate revisions by 3 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os02g0543000''''' was reported as '''''ASR1''''' in 2016 <ref name="ref1" /> by researchers from Brazil and USA.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os02g0543000''''' '''''<=>''''' '''''ASR1'''''
 
===Function===
 
===Function===
Please input function information here.
+
*'''''ASR1''''' act in concert andcomplementarily to regulate gene expression in response to Al.
  
===Expression===
+
===Phenotypic analysis===
Please input expression information here.
+
*Plants with artificial microRNA silencing of ASR5 present a non-transformed phenotype in response to Al because of the induction of '''''ASR1'''''.
 
+
*'''''ASR1''''' has the same sub-cellular localization as ASR5, binds to ASR5 cis-regulatory el-ements, regulates ASR5 regulated genes in a non-preferentialmanner and might replace ASR5 under certain conditions.
===Evolution===
 
Please input evolution information here.
 
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* Programa de Pós-Graduação em Genética e Biologia Molecular – Departamento de Genética, Universidade Federal do Rio Grandedo Sul, Porto Alegre, Brazil
 
+
*Centro de Biotecnologia, Universidade Federal do Rio Grande do Sul, Porto Alegre, Brazil
 +
*Department of Plant Biology, Carnegie Institution for Science, Stanford, CA 94305, USA
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Arenhart RA, Schunemann M, Bucker Neto L, Margis R, Wang ZY, Margis-Pinheiro M. Rice ASR1 and ASR5 are complementary transcription factors regulating aluminium responsive genes. Plant Cell Environ. 2016 Mar;39(3):645-51. doi:10.1111/pce.12655. Epub 2015 Dec 14. PubMed PMID: 26476017.
 +
</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]]
GeneName = Os02g0543000|
 
Description = ABA/WDS induced protein family protein|
 
Version = NM_001053606.2 GI:297599386 GeneID:4329601|
 
Length = 807 bp|
 
Definition = Oryza sativa Japonica Group Os02g0543000, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
 
AP = Chromosome 2:21023532..21024338|
 
CDS = 21023712..21023788,21023850..21023889,21024108..21024266|
 
GCID = <gbrowseImage1>
 
name=NC_008395:21023532..21024338
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008395:21023532..21024338
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggctgaggagaagaagcaccaccacctgttccaccacaagaaggacggggaggaggagagctccggcgtggtggactacgacaaggagaagaagcaccacaagcacctcgagcagctcggcggcctcggcgccatcgccgccggcgcctacgctctccacgagaagcaccaggcgaagaaggacacggagaacgcgccttccacgagcaccacgagaagaaggacgccaagaagcacgccgccgaccaatactagatcgatcccgatcgaatga</cdnaseq>|
 
AA = <aaseq>MAEEKKHHHLFHHKKDGEEESSGVVDYDKEKKHHKHLEQLGGLG                    AIAAGAYALHEKHQAKKDTENAPSTSTTRRRTPRSTPPTNTRSIPIE</aaseq>|
 
DNA = <dnaseqindica>551..627#450..489#73..231#acagatcaacaccggcaaccgactaactctgtctgaaggaagctaagattattaatcagtgagtagctagccatggctgaggagaagaagcaccaccacctgttccaccacaagaaggacggggaggaggagagctccggcgtggtggactacgacaaggagaagaagcaccacaagcacctcgagcagctcggcggcctcggcgccatcgccgccggcgcctacgctctcgtaagtcattaattagtacatttgaccaccactattacaagaaaatcgattttcgcagacgtatatgtcatcccccactttaactaacctatatgttttagccgcttggaaaaatcgattatgtagtggtgaactatgatctaatgataactacctagccatagctgattaattaagagataattaacggagaatttatttgtggtacgtcgttgcagcacgagaagcaccaggcgaagaaggacacggagaacgcgcacgggcacaaggtgaaggaggaggtggcggcggtggccgcgctgggcgccgcggggttcgccttccacgagcaccacgagaagaaggacgccaagaagcacgccgccgaccaatactagatcgatcccgatcgaatgaacgcaagaacgaacggtttatatgcttaattactttctccccataattacatgtatgcatgtggttgatggcttaatttgcttcttcttgttcgtcgtcatacgtcgtcgcttttacttcgtgttcatgtacattaattctgtatccgcactgagtattaaataagtgcgtttgtgctgc</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001053606.2 RefSeq:Os02g0543000]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 2]]
 
[[Category:Chromosome 2]]
 

Latest revision as of 02:44, 2 June 2017

The rice Os02g0543000 was reported as ASR1 in 2016 [1] by researchers from Brazil and USA.

Annotated Information

Gene Symbol

  • Os02g0543000 <=> ASR1

Function

  • ASR1 act in concert andcomplementarily to regulate gene expression in response to Al.

Phenotypic analysis

  • Plants with artificial microRNA silencing of ASR5 present a non-transformed phenotype in response to Al because of the induction of ASR1.
  • ASR1 has the same sub-cellular localization as ASR5, binds to ASR5 cis-regulatory el-ements, regulates ASR5 regulated genes in a non-preferentialmanner and might replace ASR5 under certain conditions.

You can also add sub-section(s) at will.

Labs working on this gene

  • Programa de Pós-Graduação em Genética e Biologia Molecular – Departamento de Genética, Universidade Federal do Rio Grandedo Sul, Porto Alegre, Brazil
  • Centro de Biotecnologia, Universidade Federal do Rio Grande do Sul, Porto Alegre, Brazil
  • Department of Plant Biology, Carnegie Institution for Science, Stanford, CA 94305, USA

References

  1. Arenhart RA, Schunemann M, Bucker Neto L, Margis R, Wang ZY, Margis-Pinheiro M. Rice ASR1 and ASR5 are complementary transcription factors regulating aluminium responsive genes. Plant Cell Environ. 2016 Mar;39(3):645-51. doi:10.1111/pce.12655. Epub 2015 Dec 14. PubMed PMID: 26476017.

Structured Information