Difference between revisions of "Os11g0167800"

From RiceWiki
Jump to: navigation, search
 
(12 intermediate revisions by 5 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os11g0167800''''' was reported as '''''ASR5''''' in 2016 <ref name="ref1" /> by researchers from Brazil and USA.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os11g0167800''''' '''''<=>''''' '''''ASR5'''''
 
===Function===
 
===Function===
Please input function information here.
+
*'''''ASR5''''' act in concert andcomplementarily to regulate gene expression in response to Al.
  
===Expression===
+
===Phenotypic analysis===
Please input expression information here.
+
*Plants with artificial microRNA silencing of ''''''ASR5''''' present a non-transformed phenotype in response to Al because of the induction of ASR1.
  
===Evolution===
 
Please input evolution information here.
 
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* Programa de Pós-Graduação em Genética e Biologia Molecular – Departamento de Genética, Universidade Federal do Rio Grandedo Sul, Porto Alegre, Brazil
 
+
*Centro de Biotecnologia, Universidade Federal do Rio Grande do Sul, Porto Alegre, Brazil
 +
*Department of Plant Biology, Carnegie Institution for Science, Stanford, CA 94305, USA
 
==References==
 
==References==
Please input cited references here.
+
<references>
 
+
* <ref name="ref1">
==Structured Information==
+
Arenhart RA, Schunemann M, Bucker Neto L, Margis R, Wang ZY, Margis-Pinheiro M. Rice ASR1 and ASR5 are complementary transcription factors regulating aluminium responsive genes. Plant Cell Environ. 2016 Mar;39(3):645-51. doi:10.1111/pce.12655. Epub 2015 Dec 14. PubMed PMID: 26476017.
{{JaponicaGene|
+
</ref>
GeneName = Os11g0167800|
+
</references>
Description = Similar to Anth (Pollen-specific desiccation-associated LLA23 protein)|
 
Version = NM_001072373.1 GI:115484358 GeneID:4349876|
 
Length = 969 bp|
 
Definition = Oryza sativa Japonica Group Os11g0167800, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|
 
AP = Chromosome 11:3261662..3262630|
 
CDS = 3262004..3262189,3262309..3262539|
 
GCID = <gbrowseImage1>
 
name=NC_008404:3261662..3262630
 
source=RiceChromosome11
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008404:3261662..3262630
 
source=RiceChromosome11
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggcggaggagaagcaccaccaccacctgttccaccacaagaaggacgacgagccggccaccggagtagactcctacggcgagggcgtctacacgtcggagacggtgaccaccgaggtggtcgccggcggccaggacgagtacgagaggtacaagaaggaggagaagcagcacaagcacaagcagcacctcggcgaggccggcgccctcgccgccggcgccttcgccctgtatgagaagcacgaggcgaagaaggacccggagaacgcgcacaggcacaagatcacggaggagatcgcggccacggcggcggtcggcgccggcggctacgccttccacgagcaccacgagaagaagaaggaccacaagagcgccgaggagtccaccggcgagaagaagcaccacctcttcggctga</cdnaseq>|
 
AA = <aaseq>MAEEKHHHHLFHHKKDDEPATGVDSYGEGVYTSETVTTEVVAGG                    QDEYERYKKEEKQHKHKQHLGEAGALAAGAFALYEKHEAKKDPENAHRHKITEEIAAT                    AAVGAGGYAFHEHHEKKKDHKSAEESTGEKKHHLFG</aaseq>|
 
DNA = <dnaseqindica>442..627#92..322#aagcaagcaaagccacatcttattgtcacttccatctcattctcctaattgtcatcactagcttctagctagcttaattaattaattagccatggcggaggagaagcaccaccaccacctgttccaccacaagaaggacgacgagccggccaccggagtagactcctacggcgagggcgtctacacgtcggagacggtgaccaccgaggtggtcgccggcggccaggacgagtacgagaggtacaagaaggaggagaagcagcacaagcacaagcagcacctcggcgaggccggcgccctcgccgccggcgccttcgccctggtaattaactaattaattaaccactaattaattgatctaacgccgccttaattaatcaattaatttgctaagaaatcatcaagaagtaattaattaagctgattaatcgtggtgtgtagtatgagaagcacgaggcgaagaaggacccggagaacgcgcacaggcacaagatcacggaggagatcgcggccacggcggcggtcggcgccggcggctacgccttccacgagcaccacgagaagaagaaggaccacaagagcgccgaggagtccaccggcgagaagaagcaccacctcttcggctgatcgacctcatcacaacgtcgccggcggcggcgacgacctcgccgtacgtcgccggccgccgtgtcgtcgatttgtgtgtgtaataatttgtcttcttctgcatgcgtggtgttgctgtttttcacaagagtctccggcctcgaccagtgagaggctgacaggtggggccgtgagttcagcttgtgttgcttgattttctctgcagccttgccctctgtgtgtccaaataagtggtgtgcatggctctctccgtgtcatgtatcaatgtatttttatctgtactttgtacaagtgaagcaatatttatcgaaccttgactttctccattctatttgaaaaacc</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001072373.1 RefSeq:Os11g0167800]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]
Line 57: Line 30:
 
[[Category:Japonica Chromosome 11]]
 
[[Category:Japonica Chromosome 11]]
 
[[Category:Chromosome 11]]
 
[[Category:Chromosome 11]]
 +
==Structured Information==

Latest revision as of 02:53, 2 June 2017

The rice Os11g0167800 was reported as ASR5 in 2016 [1] by researchers from Brazil and USA.

Annotated Information

Gene Symbol

  • Os11g0167800 <=> ASR5

Function

  • ASR5 act in concert andcomplementarily to regulate gene expression in response to Al.

Phenotypic analysis

  • Plants with artificial microRNA silencing of 'ASR5 present a non-transformed phenotype in response to Al because of the induction of ASR1.


You can also add sub-section(s) at will.

Labs working on this gene

  • Programa de Pós-Graduação em Genética e Biologia Molecular – Departamento de Genética, Universidade Federal do Rio Grandedo Sul, Porto Alegre, Brazil
  • Centro de Biotecnologia, Universidade Federal do Rio Grande do Sul, Porto Alegre, Brazil
  • Department of Plant Biology, Carnegie Institution for Science, Stanford, CA 94305, USA

References

  1. Arenhart RA, Schunemann M, Bucker Neto L, Margis R, Wang ZY, Margis-Pinheiro M. Rice ASR1 and ASR5 are complementary transcription factors regulating aluminium responsive genes. Plant Cell Environ. 2016 Mar;39(3):645-51. doi:10.1111/pce.12655. Epub 2015 Dec 14. PubMed PMID: 26476017.

Structured Information