Difference between revisions of "Os02g0491600"

From RiceWiki
Jump to: navigation, search
 
(2 intermediate revisions by 2 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os02g0491600''''' was reported as '''''OsGLP2-1''''' in 2016 <ref name="ref1" /> by researchers from China.  
  
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
* The germin-like protein OsGLP2-1 enhances resistance to fungal blast and bacterial blight in rice.
 +
* OsGLP2-1 functions as a positive regulator to modulate disease resistance. Its good quantitative resistance to the two major diseases in rice makes it to be a promising target in rice breeding.
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
* Overexpression of OsGLP2-1 quantitatively enhanced resistance to leaf blast, panicle blast and bacterial blight.
 +
* Compared with empty vector transformed (control) plants, the OsGLP2-1 overexpressing plants exhibited higher levels of H2O2 both before and after pathogen inoculation.
 +
* Overexpression of OsGLP2-1 induced three well-characterized defense-related genes which are associated in JA-dependent pathway after pathogen infection.  
  
===Evolution===
+
===Subcellular localization===
Please input evolution information here.
+
* The temporal and spatial expression analysis revealed that OsGLP2-1is highly expressed in leaves and panicles and sub-localized in the cell wall.  
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* State Key Laboratory of Plant Physiology and Biochemistry, College of Life Sciences, Zhejiang University, Hangzhou, China;
 +
* Department of Biology - Plant Biology, University of Fribourg, Rue Albert-Gockel 3, CH-1700 Fribourg, Switzerland
 +
* State Key Laboratory of Plant Genomics, National Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing, China.
 +
* State Key Laboratory of Rice Biology, China National Rice Research Institute, Chinese Academy of Agricultural Sciences, Hangzhou, China
 +
* State Key Laboratory of Molecular Developmental Biology, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing, China.
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Liu Q, Yang J, Yan S, Zhang S, Zhao J, Wang W, Yang T, Wang X, Mao X, Dong J,
 +
Zhu X, Liu B. The germin-like protein OsGLP2-1 enhances resistance to fungal
 +
blast and bacterial blight in rice. Plant Mol Biol. 2016 Nov;92(4-5):411-423.
 +
Epub 2016 Sep 15. PubMed PMID: 27631432.
 +
</ref>
 +
</references>
 +
 
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]]
GeneName = Os02g0491600|
 
Description = Similar to Oxalate oxidase-like protein or germin-like protein (Germin-like 8) (Germin-like 12)|
 
Version = NM_001053409.1 GI:115446188 GeneID:4329389|
 
Length = 810 bp|
 
Definition = Oryza sativa Japonica Group Os02g0491600, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
 
AP = Chromosome 2:17944048..17944857|
 
CDS = 17944048..17944583,17944743..17944857|
 
GCID = <gbrowseImage1>
 
name=NC_008395:17944048..17944857
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008395:17944048..17944857
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggcctcaacatggttcttcctccttgccctcctggctgtatcgatttcgaatgctttcgcctccgatcccagccaactccaggacttctgcgtcgctgacaagatgtcgcaagttctagtcaatggatttgcatgcaaggacccagcggccatcaccgtggaagacttcttcttctccggccttcacatggctggaaacaccagcaacaggcagggatcggccgtgacaggagtcaacgtcgcccagatctctgggctcaacaccttgggcatctctttggcccgcgtcgactatgcgccctatggtcttaaccctccgcacattcacccacgtgcgaccgagatcctgactatactggagggctcactctacgtcggcttcgttacctccaaccccgagaacaagctgttcaccaaggttcttaacaagggggacgtattcgtgtttcctcaggggttgatccactttcagttcaactatggtacaaaagatgttatagcccttgcggctctaagtagccagaaccctggagtcatcaccatagcaaatgcggtgtttggatcgaagccgttcatatcagatgatatccttgccaaggcctttcaggtggagaagaagatagtagaccggattcaagctcagttctga</cdnaseq>|
 
AA = <aaseq>MASTWFFLLALLAVSISNAFASDPSQLQDFCVADKMSQVLVNGF                    ACKDPAAITVEDFFFSGLHMAGNTSNRQGSAVTGVNVAQISGLNTLGISLARVDYAPY                    GLNPPHIHPRATEILTILEGSLYVGFVTSNPENKLFTKVLNKGDVFVFPQGLIHFQFN                    YGTKDVIALAALSSQNPGVITIANAVFGSKPFISDDILAKAFQVEKKIVDRIQAQF</aaseq>|
 
DNA = <dnaseqindica>275..810#1..115#atggcctcaacatggttcttcctccttgccctcctggctgtatcgatttcgaatgctttcgcctccgatcccagccaactccaggacttctgcgtcgctgacaagatgtcgcaaggtaatactgcaaacatgctacagttagtttccatatattttacttatatgtgcatttaaatcagtaatatagcgtgtacttgtctttagggttaaacagggtaattttgttgttaactaatccgattgaactattctacatgtttgggcaaacttgcagttctagtcaatggatttgcatgcaaggacccagcggccatcaccgtggaagacttcttcttctccggccttcacatggctggaaacaccagcaacaggcagggatcggccgtgacaggagtcaacgtcgcccagatctctgggctcaacaccttgggcatctctttggcccgcgtcgactatgcgccctatggtcttaaccctccgcacattcacccacgtgcgaccgagatcctgactatactggagggctcactctacgtcggcttcgttacctccaaccccgagaacaagctgttcaccaaggttcttaacaagggggacgtattcgtgtttcctcaggggttgatccactttcagttcaactatggtacaaaagatgttatagcccttgcggctctaagtagccagaaccctggagtcatcaccatagcaaatgcggtgtttggatcgaagccgttcatatcagatgatatccttgccaaggcctttcaggtggagaagaagatagtagaccggattcaagctcagttctga</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001053409.1 RefSeq:Os02g0491600]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 2]]
 
[[Category:Chromosome 2]]
 

Latest revision as of 13:57, 17 January 2018

The rice Os02g0491600 was reported as OsGLP2-1 in 2016 [1] by researchers from China.

Annotated Information

Function

  • The germin-like protein OsGLP2-1 enhances resistance to fungal blast and bacterial blight in rice.
  • OsGLP2-1 functions as a positive regulator to modulate disease resistance. Its good quantitative resistance to the two major diseases in rice makes it to be a promising target in rice breeding.

Expression

  • Overexpression of OsGLP2-1 quantitatively enhanced resistance to leaf blast, panicle blast and bacterial blight.
  • Compared with empty vector transformed (control) plants, the OsGLP2-1 overexpressing plants exhibited higher levels of H2O2 both before and after pathogen inoculation.
  • Overexpression of OsGLP2-1 induced three well-characterized defense-related genes which are associated in JA-dependent pathway after pathogen infection.

Subcellular localization

  • The temporal and spatial expression analysis revealed that OsGLP2-1is highly expressed in leaves and panicles and sub-localized in the cell wall.

You can also add sub-section(s) at will.

Labs working on this gene

  • State Key Laboratory of Plant Physiology and Biochemistry, College of Life Sciences, Zhejiang University, Hangzhou, China;
  • Department of Biology - Plant Biology, University of Fribourg, Rue Albert-Gockel 3, CH-1700 Fribourg, Switzerland
  • State Key Laboratory of Plant Genomics, National Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing, China.
  • State Key Laboratory of Rice Biology, China National Rice Research Institute, Chinese Academy of Agricultural Sciences, Hangzhou, China
  • State Key Laboratory of Molecular Developmental Biology, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing, China.

References

  1. Liu Q, Yang J, Yan S, Zhang S, Zhao J, Wang W, Yang T, Wang X, Mao X, Dong J, Zhu X, Liu B. The germin-like protein OsGLP2-1 enhances resistance to fungal blast and bacterial blight in rice. Plant Mol Biol. 2016 Nov;92(4-5):411-423. Epub 2016 Sep 15. PubMed PMID: 27631432.


Structured Information