Difference between revisions of "Os02g0491600"

From RiceWiki
Jump to: navigation, search
(Created page with "{{JaponicaGene| GeneName = Os02g0491600| Description = Similar to Oxalate oxidase-like protein or germin-like protein (Germin-like 8) (Germin-like 12)| Version = NM_0010534...")
 
 
(3 intermediate revisions by 3 users not shown)
Line 1: Line 1:
{{JaponicaGene|
+
The rice '''''Os02g0491600''''' was reported as '''''OsGLP2-1''''' in 2016 <ref name="ref1" /> by researchers from China.  
GeneName = Os02g0491600|
 
Description = Similar to Oxalate oxidase-like protein or germin-like protein (Germin-like 8) (Germin-like 12)|
 
Version = NM_001053409.1 GI:115446188 GeneID:4329389|
 
Length = 810 bp|
 
Definition = Oryza sativa Japonica Group Os02g0491600, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
+
==Annotated Information==
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
+
===Function===
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
+
* The germin-like protein OsGLP2-1 enhances resistance to fungal blast and bacterial blight in rice.
            clade; Ehrhartoideae; Oryzeae; Oryza.
+
* OsGLP2-1 functions as a positive regulator to modulate disease resistance. Its good quantitative resistance to the two major diseases in rice makes it to be a promising target in rice breeding.
|
+
 
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
+
===Expression===
AP = Chromosome 2:17944048..17944857|
+
* Overexpression of OsGLP2-1 quantitatively enhanced resistance to leaf blast, panicle blast and bacterial blight.  
CDS = 17944048..17944583,17944743..17944857|
+
* Compared with empty vector transformed (control) plants, the OsGLP2-1 overexpressing plants exhibited higher levels of H2O2 both before and after pathogen inoculation.
GCID = <gbrowseImage1>
+
* Overexpression of OsGLP2-1 induced three well-characterized defense-related genes which are associated in JA-dependent pathway after pathogen infection.  
name=NC_008395:17944048..17944857
+
 
source=RiceChromosome02
+
===Subcellular localization===
preset=GeneLocation
+
* The temporal and spatial expression analysis revealed that OsGLP2-1is highly expressed in leaves and panicles and sub-localized in the cell wall.  
</gbrowseImage1>|
+
 
GSID = <gbrowseImage2>
+
You can also add sub-section(s) at will.
name=NC_008395:17944048..17944857
+
 
source=RiceChromosome02
+
==Labs working on this gene==
preset=GeneLocation
+
* State Key Laboratory of Plant Physiology and Biochemistry, College of Life Sciences, Zhejiang University, Hangzhou, China;
</gbrowseImage2>|
+
* Department of Biology - Plant Biology, University of Fribourg, Rue Albert-Gockel 3, CH-1700 Fribourg, Switzerland
CDNA = <cdnaseq>atggcctcaacatggttcttcctccttgccctcctggctgtatcgatttcgaatgctttcgcctccgatcccagccaactccaggacttctgcgtcgctgacaagatgtcgcaagttctagtcaatggatttgcatgcaaggacccagcggccatcaccgtggaagacttcttcttctccggccttcacatggctggaaacaccagcaacaggcagggatcggccgtgacaggagtcaacgtcgcccagatctctgggctcaacaccttgggcatctctttggcccgcgtcgactatgcgccctatggtcttaaccctccgcacattcacccacgtgcgaccgagatcctgactatactggagggctcactctacgtcggcttcgttacctccaaccccgagaacaagctgttcaccaaggttcttaacaagggggacgtattcgtgtttcctcaggggttgatccactttcagttcaactatggtacaaaagatgttatagcccttgcggctctaagtagccagaaccctggagtcatcaccatagcaaatgcggtgtttggatcgaagccgttcatatcagatgatatccttgccaaggcctttcaggtggagaagaagatagtagaccggattcaagctcagttctga</cdnaseq>|
+
* State Key Laboratory of Plant Genomics, National Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing, China.
AA = <aaseq>MASTWFFLLALLAVSISNAFASDPSQLQDFCVADKMSQVLVNGF                    ACKDPAAITVEDFFFSGLHMAGNTSNRQGSAVTGVNVAQISGLNTLGISLARVDYAPY                    GLNPPHIHPRATEILTILEGSLYVGFVTSNPENKLFTKVLNKGDVFVFPQGLIHFQFN                    YGTKDVIALAALSSQNPGVITIANAVFGSKPFISDDILAKAFQVEKKIVDRIQAQF</aaseq>|
+
* State Key Laboratory of Rice Biology, China National Rice Research Institute, Chinese Academy of Agricultural Sciences, Hangzhou, China
DNA = <dnaseqindica>275..810#1..115#atggcctcaacatggttcttcctccttgccctcctggctgtatcgatttcgaatgctttcgcctccgatcccagccaactccaggacttctgcgtcgctgacaagatgtcgcaaggtaatactgcaaacatgctacagttagtttccatatattttacttatatgtgcatttaaatcagtaatatagcgtgtacttgtctttagggttaaacagggtaattttgttgttaactaatccgattgaactattctacatgtttgggcaaacttgcagttctagtcaatggatttgcatgcaaggacccagcggccatcaccgtggaagacttcttcttctccggccttcacatggctggaaacaccagcaacaggcagggatcggccgtgacaggagtcaacgtcgcccagatctctgggctcaacaccttgggcatctctttggcccgcgtcgactatgcgccctatggtcttaaccctccgcacattcacccacgtgcgaccgagatcctgactatactggagggctcactctacgtcggcttcgttacctccaaccccgagaacaagctgttcaccaaggttcttaacaagggggacgtattcgtgtttcctcaggggttgatccactttcagttcaactatggtacaaaagatgttatagcccttgcggctctaagtagccagaaccctggagtcatcaccatagcaaatgcggtgtttggatcgaagccgttcatatcagatgatatccttgccaaggcctttcaggtggagaagaagatagtagaccggattcaagctcagttctga</dnaseqindica>|
+
* State Key Laboratory of Molecular Developmental Biology, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing, China.
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001053409.1 RefSeq:Os02g0491600]|
+
 
}}
+
==References==
[[Category:Genes]]
+
<references>
[[Category:Japonica mRNA]]
+
* <ref name="ref1">
[[Category:Oryza Sativa Japonica Group]]
+
Liu Q, Yang J, Yan S, Zhang S, Zhao J, Wang W, Yang T, Wang X, Mao X, Dong J,
[[Category:Japonica Genes]]
+
Zhu X, Liu B. The germin-like protein OsGLP2-1 enhances resistance to fungal
[[Category:Japonica Chromosome 2]]
+
blast and bacterial blight in rice. Plant Mol Biol. 2016 Nov;92(4-5):411-423.
[[Category:Chromosome 2]]
+
Epub 2016 Sep 15. PubMed PMID: 27631432.
 +
</ref>
 +
</references>
 +
 
 +
 
 +
==Structured Information==
 +
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]]

Latest revision as of 13:57, 17 January 2018

The rice Os02g0491600 was reported as OsGLP2-1 in 2016 [1] by researchers from China.

Annotated Information

Function

  • The germin-like protein OsGLP2-1 enhances resistance to fungal blast and bacterial blight in rice.
  • OsGLP2-1 functions as a positive regulator to modulate disease resistance. Its good quantitative resistance to the two major diseases in rice makes it to be a promising target in rice breeding.

Expression

  • Overexpression of OsGLP2-1 quantitatively enhanced resistance to leaf blast, panicle blast and bacterial blight.
  • Compared with empty vector transformed (control) plants, the OsGLP2-1 overexpressing plants exhibited higher levels of H2O2 both before and after pathogen inoculation.
  • Overexpression of OsGLP2-1 induced three well-characterized defense-related genes which are associated in JA-dependent pathway after pathogen infection.

Subcellular localization

  • The temporal and spatial expression analysis revealed that OsGLP2-1is highly expressed in leaves and panicles and sub-localized in the cell wall.

You can also add sub-section(s) at will.

Labs working on this gene

  • State Key Laboratory of Plant Physiology and Biochemistry, College of Life Sciences, Zhejiang University, Hangzhou, China;
  • Department of Biology - Plant Biology, University of Fribourg, Rue Albert-Gockel 3, CH-1700 Fribourg, Switzerland
  • State Key Laboratory of Plant Genomics, National Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing, China.
  • State Key Laboratory of Rice Biology, China National Rice Research Institute, Chinese Academy of Agricultural Sciences, Hangzhou, China
  • State Key Laboratory of Molecular Developmental Biology, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing, China.

References

  1. Liu Q, Yang J, Yan S, Zhang S, Zhao J, Wang W, Yang T, Wang X, Mao X, Dong J, Zhu X, Liu B. The germin-like protein OsGLP2-1 enhances resistance to fungal blast and bacterial blight in rice. Plant Mol Biol. 2016 Nov;92(4-5):411-423. Epub 2016 Sep 15. PubMed PMID: 27631432.


Structured Information