Difference between revisions of "Os03g0198600"

From RiceWiki
Jump to: navigation, search
(Created page with "{{JaponicaGene| GeneName = Os03g0198600| Description = Similar to HAHB-7 (Fragment)| Version = NM_001055815.1 GI:115451358 GeneID:4331956| Length = 1407 bp| Definition = ...")
 
 
(3 intermediate revisions by 3 users not shown)
Line 1: Line 1:
{{JaponicaGene|
+
The rice '''''Os03g0198600''''' was reported as '''''HOX12''''' in 2016 <ref name="ref1" /> by researchers from China.  
GeneName = Os03g0198600|
 
Description = Similar to HAHB-7 (Fragment)|
 
Version = NM_001055815.1 GI:115451358 GeneID:4331956|
 
Length = 1407 bp|
 
Definition = Oryza sativa Japonica Group Os03g0198600, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
+
==Annotated Information==
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
+
===Gene Symbol===
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
+
*'''''Os03g0198600''''' '''''<=>''''' '''''OsHox12''''','''''Hox12'''''
            clade; Ehrhartoideae; Oryzeae; Oryza.
+
===Function===
|
+
* Rice HOX12 regulates panicle exsertion by directly modulating the expression of ELONGATED UPPERMOST INTERNODE1 (EUI1).  
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|
+
 
AP = Chromosome 3:5208115..5209521|
+
===Expression===
CDS = 5208351..5208644,5208766..5209109,5209229..5209310|
+
* Diminished HOX12 expression by RNA interference enhanced panicle exsertion, mimicking the eui1 phenotype. HOX12 knockdown plants contain higher levels of the major biologically active GAs (such as GA1 and GA4) than the wild type.
GCID = <gbrowseImage1>
+
* The expression of EUI1 is elevated in the ree1-D mutant but reduced in HOX12 knockdown plants. Interestingly, both HOX12 and EUI1 are predominantly expressed in panicles, where GA4 is highly accumulated.  
name=NC_008396:5208115..5209521
+
 
source=RiceChromosome03
+
===Subcellular localization===
preset=GeneLocation
+
* The researchers further investigated the subcellular localization of HOX12 by expressing HOX12-enhanced GFP (eGFP) fusion proteins under the control of the CaMV 35S promoter in rice protoplasts. Empty eGFP vector was transfected into rice protoplasts as a control. As expected, eGFP itself was distributed evenly in the cytoplasm and the nucleus, whereas theHOX12-eGFP fusion protein was preferentially localized to the nucleus.
</gbrowseImage1>|
+
*  Yeast one-hybrid, electrophoretic mobility shift assay, and chromatin immunoprecipitation analyses showed that HOX12 physically interacts with the EUI1 promoter both in vitro and in vivo. Furthermore, plants overexpressing HOX12 in the eui1 mutant background retained the elongated uppermost internode phenotype.
GSID = <gbrowseImage2>
+
 
name=NC_008396:5208115..5209521
+
You can also add sub-section(s) at will.
source=RiceChromosome03
+
 
preset=GeneLocation
+
==Labs working on this gene==
</gbrowseImage2>|
+
* State Key Laboratory of Plant Physiology and Biochemistry, College of Life Sciences, Zhejiang University, Hangzhou, China;
CDNA = <cdnaseq>atgagccgtgaggaggatgagaagctgctgttcccttcgttcgccttcccggcggagtgcttcccggaagccgccacctccggtggcgagcagaagaaggctcggcagcggcggaggaggaaggtgaagccggaagcggcggcagcgttggctggagagagcggaggggatgagcaggcgaagaagcggcggctgagcgacgagcaggcgcggtttctggagatgagcttcaagaaggagcggaagctggagacgccgcgcaaggtgcagctcgccgcggagctgggcctcgacgccaagcaggtcgccgtctggttccagaaccgccgcgcccgccacaagagcaagctcatggaggaggagttcgccaagctccgctccgcccacgacgccgtcgtcctccagaactgccacctcgagaccgagttgctgaagctgaaggagaggctggcggatgtagaggaggagaaggcgaagctagcagctgtcgccgcggcgacgaccggcggcggtggtggcggcggcggcggcagcagcagcccgacctcgtcgtcgttctccacggtgacgtaccacccggcgctggcggggcagttcggcgtggaggcggcggccgaggaggccgacctcacctacatgagtgagtacgcgtacaacagctacatgctggagttggcggcggccggctactgcggcggggtctacgaccaattcagctga</cdnaseq>|
+
* Department of Biology - Plant Biology, University of Fribourg, Rue Albert-Gockel 3, CH-1700 Fribourg, Switzerland
AA = <aaseq>MSREEDEKLLFPSFAFPAECFPEAATSGGEQKKARQRRRRKVKP                    EAAAALAGESGGDEQAKKRRLSDEQARFLEMSFKKERKLETPRKVQLAAELGLDAKQV                    AVWFQNRRARHKSKLMEEEFAKLRSAHDAVVLQNCHLETELLKLKERLADVEEEKAKL                    AAVAAATTGGGGGGGGGSSSPTSSSFSTVTYHPALAGQFGVEAAAEEADLTYMSEYAY                    NSYMLELAAAGYCGGVYDQFS</aaseq>|
+
* State Key Laboratory of Plant Genomics, National Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing, China.
DNA = <dnaseqindica>878..1171#413..756#212..293#acagactcggacaccaccggtcacttgaattgtcaagctagctagccttctcatcagcctggctctcagtctcaaagaaagcacaaaggtagctagcttagcatcgattgaagctgaccagagagatagttaagaatttgccatagcttagtgtttggtgcatacacacaactgctctcgttgtttttgctcttttgggttcgctcggaagatgagccgtgaggaggatgagaagctgctgttcccttcgttcgccttcccggcggagtgcttcccggaagccgccacctccggtacgtacgcgcgtttctttgtctcttctttacctcgcccaagtgtgctgcttcgcaagctggagctgatggcaatgtgttcttgtctctcttttgtttggttggttgttgtgttgcaggtggcgagcagaagaaggctcggcagcggcggaggaggaaggtgaagccggaagcggcggcagcgttggctggagagagcggaggggatgagcaggcgaagaagcggcggctgagcgacgagcaggcgcggtttctggagatgagcttcaagaaggagcggaagctggagacgccgcgcaaggtgcagctcgccgcggagctgggcctcgacgccaagcaggtcgccgtctggttccagaaccgccgcgcccgccacaagagcaagctcatggaggaggagttcgccaagctccgctccgcccacgacgccgtcgtcctccagaactgccacctcgagaccgaggtaactagccaactcgatcgaacagacgaacaccacacagtacatcgcgcgctcgttctcgttcgttcgtcgttgctgatggagatgaactgtggcttaattttgattaacgtacttgcagttgctgaagctgaaggagaggctggcggatgtagaggaggagaaggcgaagctagcagctgtcgccgcggcgacgaccggcggcggtggtggcggcggcggcggcagcagcagcccgacctcgtcgtcgttctccacggtgacgtaccacccggcgctggcggggcagttcggcgtggaggcggcggccgaggaggccgacctcacctacatgagtgagtacgcgtacaacagctacatgctggagttggcggcggccggctactgcggcggggtctacgaccaattcagctgagcgccgccactcgccggggccggcgccgacggaggattaactagctacagtagctgttaattaatggatcgatcaattgcagggtagtaattcagtagtggtggtgtttattagtagtatcaatgatcgatatatcatcagtcgtgttgccctaacgaaaaatctttagcggtgactttgctaagccatgtagattattaaattggatgtctttgtaagtatatgtgtttagaata</dnaseqindica>|
+
* State Key Laboratory of Rice Biology, China National Rice Research Institute, Chinese Academy of Agricultural Sciences, Hangzhou, China
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001055815.1 RefSeq:Os03g0198600]|
+
* State Key Laboratory of Molecular Developmental Biology, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing, China.
}}
+
 
[[Category:Genes]]
+
==References==
[[Category:Japonica mRNA]]
+
<references>
[[Category:Oryza Sativa Japonica Group]]
+
* <ref name="ref1">
[[Category:Japonica Genes]]
+
Gao S, Fang J, Xu F, Wang W, Chu C. Rice HOX12 Regulates Panicle Exsertion by
[[Category:Japonica Chromosome 3]]
+
Directly Modulating the Expression of ELONGATED UPPERMOST INTERNODE1. Plant Cell.
[[Category:Chromosome 3]]
+
2016 Mar;28(3):680-95. doi: 10.1105/tpc.15.01021. Epub 2016 Mar 14. PubMed PMID:
 +
26977084; PubMed Central PMCID: PMC4826014.
 +
</ref>
 +
</references>
 +
 
 +
 
 +
==Structured Information==
 +
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 3]]

Latest revision as of 04:34, 18 January 2018

The rice Os03g0198600 was reported as HOX12 in 2016 [1] by researchers from China.

Annotated Information

Gene Symbol

  • Os03g0198600 <=> OsHox12,Hox12

Function

  • Rice HOX12 regulates panicle exsertion by directly modulating the expression of ELONGATED UPPERMOST INTERNODE1 (EUI1).

Expression

  • Diminished HOX12 expression by RNA interference enhanced panicle exsertion, mimicking the eui1 phenotype. HOX12 knockdown plants contain higher levels of the major biologically active GAs (such as GA1 and GA4) than the wild type.
  • The expression of EUI1 is elevated in the ree1-D mutant but reduced in HOX12 knockdown plants. Interestingly, both HOX12 and EUI1 are predominantly expressed in panicles, where GA4 is highly accumulated.

Subcellular localization

  • The researchers further investigated the subcellular localization of HOX12 by expressing HOX12-enhanced GFP (eGFP) fusion proteins under the control of the CaMV 35S promoter in rice protoplasts. Empty eGFP vector was transfected into rice protoplasts as a control. As expected, eGFP itself was distributed evenly in the cytoplasm and the nucleus, whereas theHOX12-eGFP fusion protein was preferentially localized to the nucleus.
  • Yeast one-hybrid, electrophoretic mobility shift assay, and chromatin immunoprecipitation analyses showed that HOX12 physically interacts with the EUI1 promoter both in vitro and in vivo. Furthermore, plants overexpressing HOX12 in the eui1 mutant background retained the elongated uppermost internode phenotype.

You can also add sub-section(s) at will.

Labs working on this gene

  • State Key Laboratory of Plant Physiology and Biochemistry, College of Life Sciences, Zhejiang University, Hangzhou, China;
  • Department of Biology - Plant Biology, University of Fribourg, Rue Albert-Gockel 3, CH-1700 Fribourg, Switzerland
  • State Key Laboratory of Plant Genomics, National Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing, China.
  • State Key Laboratory of Rice Biology, China National Rice Research Institute, Chinese Academy of Agricultural Sciences, Hangzhou, China
  • State Key Laboratory of Molecular Developmental Biology, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing, China.

References

  1. Gao S, Fang J, Xu F, Wang W, Chu C. Rice HOX12 Regulates Panicle Exsertion by Directly Modulating the Expression of ELONGATED UPPERMOST INTERNODE1. Plant Cell. 2016 Mar;28(3):680-95. doi: 10.1105/tpc.15.01021. Epub 2016 Mar 14. PubMed PMID: 26977084; PubMed Central PMCID: PMC4826014.


Structured Information