Difference between revisions of "Os03g0191400"

From RiceWiki
Jump to: navigation, search
 
(One intermediate revision by one other user not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os03g0191400''''' was reported as '''''OsRab6a''''' in 2016 <ref name="ref1" /> by researchers from China.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os04g0459000''''' '''''<=>''''' '''''OsRab6B2''''','''''OsRab6a'''''
 
===Function===
 
===Function===
Please input function information here.
+
* OsRab6a plays an important role in the regulation of Fe acquisition in rice plants by modulating Downloaded from http://pcp.oxfordjournals.org/ at Loyola University of Chicago on April 25, 20164 physiological processes involved in Fe acquisition and root system architecture in response to Fe-deficient medium.
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
* The expression of OsRab6a was rapidly and transiently up-regulated by Fe deficiency.
 +
* No differences in growth and development among the OsRab6a-overexpression, OsRab6a-RNAi and wild-type plants were detected when grown in Fe-sufficient medium.
 +
* However, overexpression of OsRab6a conferred rice plants greater tolerance to Fe deficiency than RNAi and wild-type plants, as evidenced by higher seedling height, greater biomass, chlorophyll contents and Fe concentrations in shoots, roots and grains in the overexpression lines.
 +
* Moreover, the overexpression lines exhibited greater root systems than wild-type and RNAi plants in Fe-deficient medium.  
  
===Evolution===
+
===Subcellular localization===
Please input evolution information here.
+
* The OsRab6a-GFP fusion gene and GFP gene were introduced into tobacco leaf cells by Agrobacterium-mediated transient transformation method, respectively. Both the OsRab6a-GFP fusion protein and GFP alone were expressed throughout the whole cell.
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* State Key Laboratory of Plant Physiology and Biochemistry, College of Life Sciences, Zhejiang University, Hangzhou, China;
 +
* Department of Biology - Plant Biology, University of Fribourg, Rue Albert-Gockel 3, CH-1700 Fribourg, Switzerland
 +
* State Key Laboratory of Plant Genomics, National Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing, China.
 +
* State Key Laboratory of Rice Biology, China National Rice Research Institute, Chinese Academy of Agricultural Sciences, Hangzhou, China
 +
* State Key Laboratory of Molecular Developmental Biology, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing, China.
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Yang A, Zhang WH. A Small GTPase, OsRab6a, is Involved in the Regulation of
 +
Iron Homeostasis in Rice. Plant Cell Physiol. 2016 Jun;57(6):1271-80. doi:
 +
10.1093/pcp/pcw073. Epub 2016 Apr 11. PubMed PMID: 27257291.
 +
</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 3]]
GeneName = Os03g0191400|
 
Description = Similar to GTP-binding protein ryh1|
 
Version = NM_001055768.1 GI:115451264 GeneID:4331906|
 
Length = 2182 bp|
 
Definition = Oryza sativa Japonica Group Os03g0191400, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|
 
AP = Chromosome 3:4742337..4744518|
 
CDS = 4742337..4742456,4743059..4743140,4743396..4743507,4744156..4744246,4744354..4744518<br>|
 
GCID = <gbrowseImage1>
 
name=NC_008396:4742337..4744518
 
source=RiceChromosome03
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008396:4742337..4744518
 
source=RiceChromosome03
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggcgccggtggtgtcggcgctggccaagtacaagctggtgttcctcggcgaccaggcggtggggaagacggccatcatcacccgcttcatgtacgacaagttcgacgccacctaccagggatacagctgggcaggagaggttccggagcttgatcccaagttacatcagggattcttctgtggcagtgattgtttacgatacaggcagtcctttttgagtatatcgaagtggattgaagaggtaaatacacaacgaggcggagatgtgatcatcgtccttgttggaaataaaacagaccttgttgacaagaggcaaatatccactgacgaaggagaagccaaggcacaggagcacggcgccatgttcatggaaaccagcgcaaaagctggattcaacatcaagccactgtttcgcaagatcgctgcatcgctgcctggaatggaggcgctctcatcggcaaagcaggaagacatggtggacataaacctacggcctgctgcctccgggcaaataccttcaggggcagaagcacaagaagaacagaaagcaggcggttgttcctgctga</cdnaseq>|
 
AA = <aaseq>MAPVVSALAKYKLVFLGDQAVGKTAIITRFMYDKFDATYQGYSW                    AGEVPELDPKLHQGFFCGSDCLRYRQSFLSISKWIEEVNTQRGGDVIIVLVGNKTDLV                    DKRQISTDEGEAKAQEHGAMFMETSAKAGFNIKPLFRKIAASLPGMEALSSAKQEDMV                    DINLRPAASGQIPSGAEAQEEQKAGGCSC</aaseq>|
 
DNA = <dnaseqindica>1..120#723..804#1060..1171#1820..1910#2018..2182#atggcgccggtggtgtcggcgctggccaagtacaagctggtgttcctcggcgaccaggcggtggggaagacggccatcatcacccgcttcatgtacgacaagttcgacgccacctaccaggttcgttgatgtcgcgcgcgtccccgatcgatcgatcttacgcgctggagagagttccagttttttttcttttttgggcaaggtttgttcgatgaatttgacggtgttcatgttgttgcggcggcggcggcggcgtgcaggcgacgatcgggatcgatttcctctccaagacgatgtacctcgaagaccgaaccgtacggctgcagctttggtatctgagattctgaaaactctctctctttgtttttcccctatcatcatactctgcttatcaagcttgtcctgcttacgagaattcagttggtgcagcttagctgctgttacttgtccgatcaccgattttactctgcacaacctgctttattaccatataatcctagtgcctactagtttcgaagtcttgatttttagtctcagttccaccctcaattacgttgatttcgttttgctgatggaggcaatattaatgctcaattgttgccctttttttatcctttcctggtgaactgaaatcacgcgcacaagacaattcagctagtgaaaactgggaggttttcagctagtaaaaaccgggagagttttatggtgatgataatgtgcagggatacagctgggcaggagaggttccggagcttgatcccaagttacatcagggattcttctgtggcagtgattgtttacgatgtgactggcaagttaacttcatctacacccttttctctctgctgttgtaactagaaagaatttgtgatcctttgccctccagtgctcttgtaaactacagtgcttttgctctaacaaggttggcacctattctgaacatgtcactgaatcagggattggcgaattgccgatacccttggaatacaaatttatcagaaaatataatataatccactgtatatttgttttgtggtctcatatcgtccttgttttcagacaggcagtcctttttgagtatatcgaagtggattgaagaggtaaatacacaacgaggcggagatgtgatcatcgtccttgttggaaataaaacagaccttgttgacaagaggttagtatctgtcggtatttagttcttaaatcagcagttcattaagtttacataaaagtaccagctgctcccaaaattaaatagatcctctgttctgttctgatggatagtattcactgatcaaatgaaataacgatataactctgtcttcaatttgacaattttaattcaatcttctggtcttggtaatgtccacacgtcaacaaagtacgaaatatcattttggctaatactccctccatttttaaaatacaaaacactgttgagtttttgacatacgttcaccattagtttattcaaaagaaattatataattatcatttattttataacttgatttatggtcaaatgtttttttaagcataactcgaatttttttatattttcacacaaaaaaatttgaataatgacttgatttatcgttaaatgttctttaagtatgacttaattttttattaaaaatgaataatgacttgatttatggttaaatgttatttaagcatgacttgatttttttattttttaaaaaaaattgaataagacgaaagataattatttttttaaaaaaaaaagtcaacggtgtgatatattaaaaaattgaggtatatcagttaacctactcctttctgtcgattggaatgtcaacaggcaaatatccactgacgaaggagaagccaaggcacaggagcacggcgccatgttcatggaaaccagcgcaaaagctggattcaacatcaaggtctccagcctttactttgtttcactttgacaagcaaatctaccactgttcttgtccatcattgctcaaaacacctgatggtaactgattgaaaacttgaaccacagccactgtttcgcaagatcgctgcatcgctgcctggaatggaggcgctctcatcggcaaagcaggaagacatggtggacataaacctacggcctgctgcctccgggcaaataccttcaggggcagaagcacaagaagaacagaaagcaggcggttgttcctgctga</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001055768.1 RefSeq:Os03g0191400]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 3]]
 
[[Category:Chromosome 3]]
 

Latest revision as of 13:26, 18 January 2018

The rice Os03g0191400 was reported as OsRab6a in 2016 [1] by researchers from China.

Annotated Information

Gene Symbol

  • Os04g0459000 <=> OsRab6B2,OsRab6a

Function

  • OsRab6a plays an important role in the regulation of Fe acquisition in rice plants by modulating Downloaded from http://pcp.oxfordjournals.org/ at Loyola University of Chicago on April 25, 20164 physiological processes involved in Fe acquisition and root system architecture in response to Fe-deficient medium.

Expression

  • The expression of OsRab6a was rapidly and transiently up-regulated by Fe deficiency.
  • No differences in growth and development among the OsRab6a-overexpression, OsRab6a-RNAi and wild-type plants were detected when grown in Fe-sufficient medium.
  • However, overexpression of OsRab6a conferred rice plants greater tolerance to Fe deficiency than RNAi and wild-type plants, as evidenced by higher seedling height, greater biomass, chlorophyll contents and Fe concentrations in shoots, roots and grains in the overexpression lines.
  • Moreover, the overexpression lines exhibited greater root systems than wild-type and RNAi plants in Fe-deficient medium.

Subcellular localization

  • The OsRab6a-GFP fusion gene and GFP gene were introduced into tobacco leaf cells by Agrobacterium-mediated transient transformation method, respectively. Both the OsRab6a-GFP fusion protein and GFP alone were expressed throughout the whole cell.

You can also add sub-section(s) at will.

Labs working on this gene

  • State Key Laboratory of Plant Physiology and Biochemistry, College of Life Sciences, Zhejiang University, Hangzhou, China;
  • Department of Biology - Plant Biology, University of Fribourg, Rue Albert-Gockel 3, CH-1700 Fribourg, Switzerland
  • State Key Laboratory of Plant Genomics, National Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing, China.
  • State Key Laboratory of Rice Biology, China National Rice Research Institute, Chinese Academy of Agricultural Sciences, Hangzhou, China
  • State Key Laboratory of Molecular Developmental Biology, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing, China.

References

  1. Yang A, Zhang WH. A Small GTPase, OsRab6a, is Involved in the Regulation of Iron Homeostasis in Rice. Plant Cell Physiol. 2016 Jun;57(6):1271-80. doi: 10.1093/pcp/pcw073. Epub 2016 Apr 11. PubMed PMID: 27257291.

Structured Information