Difference between revisions of "Os01g0141000"

From RiceWiki
Jump to: navigation, search
(Created page with "{{JaponicaGene| GeneName = Os01g0141000| Description = Similar to RAV-like protein| Version = NM_001048517.1 GI:115434447 GeneID:4325479| Length = 1510 bp| Definition = O...")
 
 
(2 intermediate revisions by 2 users not shown)
Line 1: Line 1:
{{JaponicaGene|
+
The rice '''''Os01g0141000''''' was reported as '''''OsRAV2''''' in 2015 <ref name="ref1" /> by researchers from China.  
GeneName = Os01g0141000|
 
Description = Similar to RAV-like protein|
 
Version = NM_001048517.1 GI:115434447 GeneID:4325479|
 
Length = 1510 bp|
 
Definition = Oryza sativa Japonica Group Os01g0141000, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
+
==Annotated Information==
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
+
===Gene Symbol===
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
+
*'''''Os01g0141000''''' '''''<=>''''' '''''OsRAV2''''','''''RAV2'''''
            clade; Ehrhartoideae; Oryzeae; Oryza.
+
===Function===
|
+
*  our results indicate that the GT-1 element directly controls the salt response of OsRAV2. This study provides a better understanding of the putative functions of OsRAVs and the molecular regulatory mechanisms of plant genes under salt stress.
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
+
 
AP = Chromosome 1:2201278..2202787|
+
===Expression===
CDS = 2201404..2202501|
+
* In this study, the expression patterns of all fve OsRAVs were examined under salt stress. Only one gene, OsRAV2, was stably induced by high-salinity treatment.  
GCID = <gbrowseImage1>
+
* Further expression profle analyses indicated that OsRAV2 is transcriptionally regulated by salt, but not KCl, osmotic stress, cold or ABA (abscisic acid) treatment.  
name=NC_008394:2201278..2202787
+
* To elucidate the regulatory mechanism of the stress response at the transcriptional level, we isolated and characterized the promoter region of OsRAV2 (POsRAV2). Transgenic analysis indicated that POsRAV2 is induced by salt stress but not osmotic stress or ABA treatment.
source=RiceChromosome01
+
 
preset=GeneLocation
+
You can also add sub-section(s) at will.
</gbrowseImage1>|
+
 
GSID = <gbrowseImage2>
+
==Labs working on this gene==
name=NC_008394:2201278..2202787
+
* State Key Laboratory of Plant Physiology and Biochemistry, College of Life Sciences, Zhejiang University, Hangzhou, China;
source=RiceChromosome01
+
* Department of Biology - Plant Biology, University of Fribourg, Rue Albert-Gockel 3, CH-1700 Fribourg, Switzerland
preset=GeneLocation
+
* State Key Laboratory of Plant Genomics, National Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing, China.
</gbrowseImage2>|
+
* State Key Laboratory of Rice Biology, China National Rice Research Institute, Chinese Academy of Agricultural Sciences, Hangzhou, China
CDNA = <cdnaseq>atgggggtggtcagcttctcctcgacttcctccggcgcgtccacggccaccaccgagtccggcggcgccgtgcggatgtcgccggagccggtggtggcggtggcggcggcggctcaacagctaccggtggtgaagggagttgactcggcggatgaggtggtgacgtcgaggccggcggcggcggcggcgcagcagtcgtcgcggtacaagggggtggtgccgcagccgaacgggaggtggggggcgcagatctacgagcggcacgcgcgggtgtggctcgggacgttccccgacgaggaggcggcggcgcgggcctacgacgtggcggcgctccggtaccgggggcgcgacgcggccaccaacttccccggggccgcggcgtcggccgccgagctcgcgttcctcgccgcgcactccaaggccgagatcgtcgacatgctccggaagcacacctacgccgacgagctccgccaggggctccgccgcggccgcggcatgggcgcccgcgcccagcccacgccgtcgtgggcgcgcgagccgctgttcgagaaggccgtgacgcccagcgacgtcggcaagctcaaccgcctcgtggtgcccaagcagcacgccgagaagcacttcccgctccgccgcgcggcgagctccgactccgcctccgccgccgccaccggcaagggcgtgctcctcaacttcgaggacggcgaggggaaggtgtggcgattccggtactcgtactggaacagcagccagagctacgtgctgaccaaggggtggagccgattcgtgagggagaagggcctccgcgccggcgacaccatagtcttctcccgctcggcgtacggccccgacaagctgctcttcatcgactgcaagaagaacaacgcggcggcggcgaccaccacctgcgccggcgacgagaggccaaccacaagcggcgccgaaccacgcgtcgtgaggctcttcggcgtcgacatcgccggcggcgattgccggaagcgggagagggcggtggagatggggcaagaggtcttcctactgaagaggcaatgcgtggttcatcagcgtactcctgccctaggtgccctgctgttatag</cdnaseq>|
+
* State Key Laboratory of Molecular Developmental Biology, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing, China.
AA = <aaseq>MGVVSFSSTSSGASTATTESGGAVRMSPEPVVAVAAAAQQLPVV                    KGVDSADEVVTSRPAAAAAQQSSRYKGVVPQPNGRWGAQIYERHARVWLGTFPDEEAA                    ARAYDVAALRYRGRDAATNFPGAAASAAELAFLAAHSKAEIVDMLRKHTYADELRQGL                    RRGRGMGARAQPTPSWAREPLFEKAVTPSDVGKLNRLVVPKQHAEKHFPLRRAASSDS                    ASAAATGKGVLLNFEDGEGKVWRFRYSYWNSSQSYVLTKGWSRFVREKGLRAGDTIVF                    SRSAYGPDKLLFIDCKKNNAAAATTTCAGDERPTTSGAEPRVVRLFGVDIAGGDCRKR                    ERAVEMGQEVFLLKRQCVVHQRTPALGALLL</aaseq>|
+
 
DNA = <dnaseqindica>127..1224#atcatcttctttggcttctccctcttcactgccctaattacaacccatttgcttatctctctcctctctctctctctctcgctgcagccatagcttagctagagctagagctttcttggtgccgagatgggggtggtcagcttctcctcgacttcctccggcgcgtccacggccaccaccgagtccggcggcgccgtgcggatgtcgccggagccggtggtggcggtggcggcggcggctcaacagctaccggtggtgaagggagttgactcggcggatgaggtggtgacgtcgaggccggcggcggcggcggcgcagcagtcgtcgcggtacaagggggtggtgccgcagccgaacgggaggtggggggcgcagatctacgagcggcacgcgcgggtgtggctcgggacgttccccgacgaggaggcggcggcgcgggcctacgacgtggcggcgctccggtaccgggggcgcgacgcggccaccaacttccccggggccgcggcgtcggccgccgagctcgcgttcctcgccgcgcactccaaggccgagatcgtcgacatgctccggaagcacacctacgccgacgagctccgccaggggctccgccgcggccgcggcatgggcgcccgcgcccagcccacgccgtcgtgggcgcgcgagccgctgttcgagaaggccgtgacgcccagcgacgtcggcaagctcaaccgcctcgtggtgcccaagcagcacgccgagaagcacttcccgctccgccgcgcggcgagctccgactccgcctccgccgccgccaccggcaagggcgtgctcctcaacttcgaggacggcgaggggaaggtgtggcgattccggtactcgtactggaacagcagccagagctacgtgctgaccaaggggtggagccgattcgtgagggagaagggcctccgcgccggcgacaccatagtcttctcccgctcggcgtacggccccgacaagctgctcttcatcgactgcaagaagaacaacgcggcggcggcgaccaccacctgcgccggcgacgagaggccaaccacaagcggcgccgaaccacgcgtcgtgaggctcttcggcgtcgacatcgccggcggcgattgccggaagcgggagagggcggtggagatggggcaagaggtcttcctactgaagaggcaatgcgtggttcatcagcgtactcctgccctaggtgccctgctgttatagcatcaaatcaaattcatatatagatcaaatcaaatcttcttctcttccatcttttttgttgttcatcgtctgttgtttcatcttcgatttagagctgttctatcttcgactttctttttttgttttttgtctttattttgcatagaagtttgtcaggtcagagattgcaaatgatcgatcaagatcgagctgtatatgtacagccttattaggaaattaagtctagagatcattcaagtatgtacaattatctaatagtacatagtaataagttctgtttctttcc</dnaseqindica>|
+
==References==
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001048517.1 RefSeq:Os01g0141000]|
+
<references>
}}
+
* <ref name="ref1">
[[Category:Genes]]
+
Duan YB, Li J, Qin RY, Xu RF, Li H, Yang YC, Ma H, Li L, Wei PC, Yang JB.
[[Category:Japonica mRNA]]
+
Identification of a regulatory element responsible for salt induction of rice
[[Category:Oryza Sativa Japonica Group]]
+
OsRAV2 through ex situ and in situ promoter analysis. Plant Mol Biol. 2016
[[Category:Japonica Genes]]
+
Jan;90(1-2):49-62. doi: 10.1007/s11103-015-0393-z. Epub 2015 Oct 19. PubMed PMID:
[[Category:Japonica Chromosome 1]]
+
26482477.
[[Category:Chromosome 1]]
+
</ref>
 +
</references>
 +
 
 +
==Structured Information==
 +
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 1]]

Latest revision as of 10:10, 20 January 2018

The rice Os01g0141000 was reported as OsRAV2 in 2015 [1] by researchers from China.

Annotated Information

Gene Symbol

  • Os01g0141000 <=> OsRAV2,RAV2

Function

  • our results indicate that the GT-1 element directly controls the salt response of OsRAV2. This study provides a better understanding of the putative functions of OsRAVs and the molecular regulatory mechanisms of plant genes under salt stress.

Expression

  • In this study, the expression patterns of all fve OsRAVs were examined under salt stress. Only one gene, OsRAV2, was stably induced by high-salinity treatment.
  • Further expression profle analyses indicated that OsRAV2 is transcriptionally regulated by salt, but not KCl, osmotic stress, cold or ABA (abscisic acid) treatment.
  • To elucidate the regulatory mechanism of the stress response at the transcriptional level, we isolated and characterized the promoter region of OsRAV2 (POsRAV2). Transgenic analysis indicated that POsRAV2 is induced by salt stress but not osmotic stress or ABA treatment.

You can also add sub-section(s) at will.

Labs working on this gene

  • State Key Laboratory of Plant Physiology and Biochemistry, College of Life Sciences, Zhejiang University, Hangzhou, China;
  • Department of Biology - Plant Biology, University of Fribourg, Rue Albert-Gockel 3, CH-1700 Fribourg, Switzerland
  • State Key Laboratory of Plant Genomics, National Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing, China.
  • State Key Laboratory of Rice Biology, China National Rice Research Institute, Chinese Academy of Agricultural Sciences, Hangzhou, China
  • State Key Laboratory of Molecular Developmental Biology, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing, China.

References

  1. Duan YB, Li J, Qin RY, Xu RF, Li H, Yang YC, Ma H, Li L, Wei PC, Yang JB. Identification of a regulatory element responsible for salt induction of rice OsRAV2 through ex situ and in situ promoter analysis. Plant Mol Biol. 2016 Jan;90(1-2):49-62. doi: 10.1007/s11103-015-0393-z. Epub 2015 Oct 19. PubMed PMID: 26482477.

Structured Information