Difference between revisions of "Os06g0324800"

From RiceWiki
Jump to: navigation, search
(Created page with "{{JaponicaGene| GeneName = Os06g0324800| Description = Major facilitator superfamily protein| Version = NM_001064058.1 GI:115467847 GeneID:4340904| Length = 1214 bp| Defi...")
 
 
(2 intermediate revisions by 2 users not shown)
Line 1: Line 1:
{{JaponicaGene|
+
The rice '''''Os06g0324800''''' was reported as '''''OsPT9''''' in 2014 <ref name="ref1" /> by researchers from China.  
GeneName = Os06g0324800|
 
Description = Major facilitator superfamily protein|
 
Version = NM_001064058.1 GI:115467847 GeneID:4340904|
 
Length = 1214 bp|
 
Definition = Oryza sativa Japonica Group Os06g0324800, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
+
==Annotated Information==
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
+
[[File:78-Os06g0324800.png|right|thumb|427px|'''Figure 1.''' ''Tissue expression pattern of OsPT9 and OsPT10 under phosphate (Pi)-sufficient (+P) and Pi-starvation (−P) conditions.<ref name="ref1" />.'']]
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
+
===Gene Symbol===
            clade; Ehrhartoideae; Oryzeae; Oryza.
+
*'''''Os06g0324800''''' '''''<=>''''' '''''PT9''''','''''OsPT9,OsPHT1;9'''''
|
+
===Function===
Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|
+
* High-affinity Km values for Pi transport of '''''OsPT9''''' and '''''OsPT10''''' were determined by yeast experiments and two-electrode voltage clamp analysis of anion transport in Xenopus oocytes expressing '''''OsPT9''''' and '''''OsPT10'''''.
AP = Chromosome 6:12748639..12749852|
+
* '''''OsPT9''''' and '''''OsPT10''''' are high-affinity Pi transporters.
CDS = 12748757..12749800|
+
* '''''OsPT9''''' and '''''OsPT10''''' redundantly function in Pi uptake.
GCID = <gbrowseImage1>
+
 
name=NC_008399:12748639..12749852
+
===Expression===
source=RiceChromosome06
+
* Semi-quantitative RT-PCR analysis of seedlings grown in solution cultures under Pi-sufficient (+P) or Pi-starvation (–P) conditions as well as starvation of other essential nutrients showed that the expression of '''''OsPT9''''' and '''''OsPT10''''' in both roots and leaves was specifically induced by Pi starvation
preset=GeneLocation
+
* The GUS staining analysis showed expression of '''''OsPT9''''' in both roots and leaves under Pi starvation (–P). In contrast, no GUS staining was observed under either Pi-sufficient (+P) or –P conditions for '''''OsPT10''''' (Fig. 1b).
</gbrowseImage1>|
+
 
GSID = <gbrowseImage2>
+
You can also add sub-section(s) at will.
name=NC_008399:12748639..12749852
+
 
source=RiceChromosome06
+
==Labs working on this gene==
preset=GeneLocation
+
* State Key Laboratory of Plant Physiology and Biochemistry, College of Life Science, Zhejiang University, Hangzhou 310058,
</gbrowseImage2>|
+
China
CDNA = <cdnaseq>cgtacaacgagcaggtatacggcgctggtggagcgcgacgtggtgaaggccaccaacgacatcggccgcgtcctggccgacctcgacctggccgccgtcgccgaggaagaggtggcggcggcggcgttgagcccgcctccggtgacgacgccgccgccgccgcgcccttcgtacggcctcttctcgcgccgcttcgtccggcagcatgggagagacctgttcgcgtgcgcggcggcgtggttcctcctcgacatcccctactacagcagcacgctgttccagtcgcagatctaccggccatggttcccgccggcggcgaaggtgaacgcgttccaggaggcgttcaacgtggccaagttccaggccgtcatcgccgtcgcctccaccatcccgggctacttcgccgccatgctcctcatcgagcgcgccggccggcggcgtctccagatggccgggttcctcctcatggccgtcttcctcttcgcgctcgcgggtccctacgatggatactggcgcgaccacgccaagaccgccggctacatcgtgctctactcgctcaccttcttctccgccaacctcgggcccaacaccaccaccttcatcctgccggcggagctcttcccggcgcgcttccggtcgacctgccacggcctgtccggagcggcggggaagctcggcgcgctcgtcggctccatcggcttcctgtgggcgtcgcagcagaaggacggcgcggcggccgggcacctgccgggcatcggcatgatgtacgcgctgttcgttcttggcgggatctgcctgctcgggctggcgctcacctacgcgttcacgccggagacgatgacgcggtcgctggaggagaacgagagcagcgtgcaggcgcagagccaggtcggcgacggcggcagcgatgccggcaatggcagtgatgggctgcgcttccacgaactaaatgttctcatggaggcggcgaccaagagccctgtgtccatggcgagctcgcacctcagcatgtcgcctatccttccgcaccggatgtctctatga</cdnaseq>|
+
* The Key Laboratory for Quality Improvement of Agricultural Products of Zhejiang Province, College of Agriculture and Food Science, Zhejiang A & F University, Lin’an 311300, China
AA = <aaseq>RTTSRYTALVERDVVKATNDIGRVLADLDLAAVAEEEVAAAALS                    PPPVTTPPPPRPSYGLFSRRFVRQHGRDLFACAAAWFLLDIPYYSSTLFQSQIYRPWF                    PPAAKVNAFQEAFNVAKFQAVIAVASTIPGYFAAMLLIERAGRRRLQMAGFLLMAVFL                    FALAGPYDGYWRDHAKTAGYIVLYSLTFFSANLGPNTTTFILPAELFPARFRSTCHGL                    SGAAGKLGALVGSIGFLWASQQKDGAAAGHLPGIGMMYALFVLGGICLLGLALTYAFT                    PETMTRSLEENESSVQAQSQVGDGGSDAGNGSDGLRFHELNVLMEAATKSPVSMASSH                    LSMSPILPHRMSL</aaseq>|
+
* Robert W. Holley Center for Agriculture and Health, USDA-ARS, Cornell University, Ithaca, NY 14853, USA
DNA = <dnaseqindica>119..1162#acaattaatttgcactttagctttatgcaagcagttgctagctgcctagctagggtgattaactagaacaaaaagggtttaagcaccgaaccaccaaaaagctaatcaccgtacttaacgtacaacgagcaggtatacggcgctggtggagcgcgacgtggtgaaggccaccaacgacatcggccgcgtcctggccgacctcgacctggccgccgtcgccgaggaagaggtggcggcggcggcgttgagcccgcctccggtgacgacgccgccgccgccgcgcccttcgtacggcctcttctcgcgccgcttcgtccggcagcatgggagagacctgttcgcgtgcgcggcggcgtggttcctcctcgacatcccctactacagcagcacgctgttccagtcgcagatctaccggccatggttcccgccggcggcgaaggtgaacgcgttccaggaggcgttcaacgtggccaagttccaggccgtcatcgccgtcgcctccaccatcccgggctacttcgccgccatgctcctcatcgagcgcgccggccggcggcgtctccagatggccgggttcctcctcatggccgtcttcctcttcgcgctcgcgggtccctacgatggatactggcgcgaccacgccaagaccgccggctacatcgtgctctactcgctcaccttcttctccgccaacctcgggcccaacaccaccaccttcatcctgccggcggagctcttcccggcgcgcttccggtcgacctgccacggcctgtccggagcggcggggaagctcggcgcgctcgtcggctccatcggcttcctgtgggcgtcgcagcagaaggacggcgcggcggccgggcacctgccgggcatcggcatgatgtacgcgctgttcgttcttggcgggatctgcctgctcgggctggcgctcacctacgcgttcacgccggagacgatgacgcggtcgctggaggagaacgagagcagcgtgcaggcgcagagccaggtcggcgacggcggcagcgatgccggcaatggcagtgatgggctgcgcttccacgaactaaatgttctcatggaggcggcgaccaagagccctgtgtccatggcgagctcgcacctcagcatgtcgcctatccttccgcaccggatgtctctatgacaatgtaaattgaaccaaagtaactaaatgtttaaaaaagtgatcattttat</dnaseqindica>|
+
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001064058.1 RefSeq:Os06g0324800]|
+
==References==
}}
+
<references>
[[Category:Genes]]
+
* <ref name="ref1">
[[Category:Japonica mRNA]]
+
Wang X, Wang Y, Piñeros MA, Wang Z, Wang W, Li C, Wu Z, Kochian LV, Wu P.
[[Category:Oryza Sativa Japonica Group]]
+
Phosphate transporters OsPHT1;9 and OsPHT1;10 are involved in phosphate uptake in
[[Category:Japonica Genes]]
+
rice. Plant Cell Environ. 2014 May;37(5):1159-70. doi: 10.1111/pce.12224. Epub
[[Category:Japonica Chromosome 6]]
+
2013 Dec 17. PubMed PMID: 24344809.
[[Category:Chromosome 6]]
+
</ref>
 +
</references>
 +
 
 +
 
 +
==Structured Information==
 +
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 6]]

Latest revision as of 09:28, 15 October 2016

The rice Os06g0324800 was reported as OsPT9 in 2014 [1] by researchers from China.

Annotated Information

Figure 1. Tissue expression pattern of OsPT9 and OsPT10 under phosphate (Pi)-sufficient (+P) and Pi-starvation (−P) conditions.[1].

Gene Symbol

  • Os06g0324800 <=> PT9,OsPT9,OsPHT1;9

Function

  • High-affinity Km values for Pi transport of OsPT9 and OsPT10 were determined by yeast experiments and two-electrode voltage clamp analysis of anion transport in Xenopus oocytes expressing OsPT9 and OsPT10.
  • OsPT9 and OsPT10 are high-affinity Pi transporters.
  • OsPT9 and OsPT10 redundantly function in Pi uptake.

Expression

  • Semi-quantitative RT-PCR analysis of seedlings grown in solution cultures under Pi-sufficient (+P) or Pi-starvation (–P) conditions as well as starvation of other essential nutrients showed that the expression of OsPT9 and OsPT10 in both roots and leaves was specifically induced by Pi starvation
  • The GUS staining analysis showed expression of OsPT9 in both roots and leaves under Pi starvation (–P). In contrast, no GUS staining was observed under either Pi-sufficient (+P) or –P conditions for OsPT10 (Fig. 1b).

You can also add sub-section(s) at will.

Labs working on this gene

  • State Key Laboratory of Plant Physiology and Biochemistry, College of Life Science, Zhejiang University, Hangzhou 310058,

China

  • The Key Laboratory for Quality Improvement of Agricultural Products of Zhejiang Province, College of Agriculture and Food Science, Zhejiang A & F University, Lin’an 311300, China
  • Robert W. Holley Center for Agriculture and Health, USDA-ARS, Cornell University, Ithaca, NY 14853, USA

References

  1. 1.0 1.1 Wang X, Wang Y, Piñeros MA, Wang Z, Wang W, Li C, Wu Z, Kochian LV, Wu P. Phosphate transporters OsPHT1;9 and OsPHT1;10 are involved in phosphate uptake in rice. Plant Cell Environ. 2014 May;37(5):1159-70. doi: 10.1111/pce.12224. Epub 2013 Dec 17. PubMed PMID: 24344809.


Structured Information