Difference between revisions of "Os04g0488700"

From RiceWiki
Jump to: navigation, search
(Structured Information)
 
(8 intermediate revisions by one other user not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The locus name of rice Os11g0523800 is AGC Kinase.Gene symbols are OsOxi1,Located on chromosome 4.
  
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
OsPti1a, a functional ortholog of tomato SlPti1, negatively regulates both basal resistance and R-gene-mediated resistance in rice. To investigate the molecular function of OsPti1a in defense responses, we searched for components interacting with OsPti1a using a yeast two-hybrid system. One of the interacting proteins is a Ser/Thr kinase that directly phosphorylates OsPti1a in vitro. This protein belongs to the AGC kinase family and is highly similar to AtOxi1, which is induced in response to a wide range of reactive oxygen species (ROS)-generating stimuli in Arabidopsis. Thus, it was designated OsOxi1. OsOxi1 was transiently phosphorylated in response to ROS and chitin elicitor. Both OsOxi1-overexpressing transgenic lines and the ospti1a mutant were highly sensitive to ROS treatment, indicating that OsOxi1 and OsPti1a are involved in ROS-mediated signaling in opposing ways.<ref name="ref1" />The AGC kinase OsOxi1, which has been isolated as an interactor with OsPti1a, positively regulates basal disease resistance in rice. In eukaryotes, AGC kinase family proteins are regulated by 3-phosphoinositide-dependent protein kinase 1 (Pdk1). In Arabidopsis, AtPdk1 directly interacts with phosphatidic acid, which functions as a second messenger in both biotic and abiotic stress responses.<ref name="ref2" />
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
OsOxi1 is specifically expressed at infection sites where ROS are produced after inoculation with a blast fungus, Magnaporthe oryzae. Overexpression of OsOxi1 enhanced basal resistance to the blast fungus, indicating that OsOxi1 positively regulates disease resistance. OsOxi1 phosphorylates Thr-233 of OsPti1a and a point mutation of Thr-233 enhanced disease susceptibility to a bacterial pathogen Xanthomonas oryzae pv. oryzae (Xoo), suggesting that the phosphorylation of OsPti1a by OsOxi1 is essential for basal resistance to Xoo. Taken together, our data suggest that OsOxi1 positively regulates defense responses through the phosphorylation of OsPti1a, causing the release from an OsPti1a-dependent inhibition of the responses.<ref name="ref1" />The functions of Pdk1 are poorly understood in plants. We show here that OsPdk1 acts upstream of the OsOxi1–OsPti1a signal cascade in disease resistance in rice. OsPdk1 interacts with OsOxi1 and phosphorylates the Ser283 residue of OsOxi1 in vitro. To investigate whether OsPdk1 is involved in immunity that is triggered by microbial-associated molecular patterns, we analyzed the phosphorylation status of OsPdk1 in response to chitin elicitor. Like OsOxi1, OsPdk1 is rapidly phosphorylated in response to chitin elicitor, suggesting that OsPdk1 participates in signal transduction through pathogen recognition. The overexpression of OsPdk1 enhanced basal resistance against a blast fungus, Magnaporthe oryzae, and a bacterial pathogen, Xanthomonas oryzae pv. oryzae (Xoo). Taken together, these results suggest that OsPdk1 positively regulates basal disease resistance through the OsOxi1–OsPti1a phosphorylation cascade in rice.<ref name="ref2" />
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
*Division of Plant Sciences, National Institute of Agrobiological Sciences, Tsukuba, Ibaraki 305-8602, Japan.
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
<ref name="ref1"> Hidenori Matsui;Muneo Yamazaki;Mitsuko Kishi-Kaboshi;Akira Takahashi;Hirohiko Hirochika
 +
  AGC Kinase OsOxi1 Positively Regulates Basal Resistance through Suppression of OsPti1a-Mediated Negative Regulation
 +
  Plant and Cell Physiology, 2010, 51(10): 1731-1744.</ref>
 +
<ref name="ref2">Hidenori Matsui;Akio Miyao;Akira Takahashi;Hirohiko Hirochika
 +
  Pdk1 Kinase Regulates Basal Disease Resistance Through the OsOxi1–OsPti1a Phosphorylation Cascade in Rice
 +
  Plant and Cell Physiology, 2010, 51(12): 2082-2091.</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os04g0488700|
 
Description = Similar to PHY3|
 
Version = NM_001059689.1 GI:115459107 GeneID:4336231|
 
Length = 2095 bp|
 
Definition = Oryza sativa Japonica Group Os04g0488700, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|
 
AP = Chromosome 4:24814867..24816961|
 
CDS = 24815352..24816330,24816444..24816853|
 
GCID = <gbrowseImage1>
 
name=NC_008397:24814867..24816961
 
source=RiceChromosome04
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008397:24814867..24816961
 
source=RiceChromosome04
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggcggcggcggcgatggcgccctcgcctccggagccggcgttgccgcgggagctcagcctgggggacctcagggcggtgtccatgctcggccggggcgccaagggcgtcgtgttccacgtcgtgcccgcggcggcgggggaggaggaggcctccatggcgctcaaggcggtctcgcgggaggcggcgcggcacaagaagaacgggagcggcggcgaggacgggcaccggcggatctggttcgagcgggacgtgctcatgtcgctgcgacacccgctgctcccctccctccgcggcgtcctcgccaccgacgccgtcgtcgggttcgccatcgaccgctgcggcggcggagacctcaactcgctccggcgccgccagaccgagaagatgttctccgactccgtcatccgcttctacgccgcggagttggtgctggcgctcgactatctgcacagcctcggcatcgtgtaccgcgacctcaagccggagaacgtcctgatacaggacagcggccacatcatgctcgtcgacttcgacctctccacgaggctcccgacgccgccgccgccaccggaggagcaggacgcaacgattgctgattccatgccggagcctccgcccagttcaccgtccccgaaccgcgcgaagggcaagaggcaaccgggggcggcctcgtgcttcccgttctgttcggtcggcgccacgaagccggccgcgtcggcggactcgccgtcgccaacgtccacctcgcgcacggcctcggcgtcgtcctcgtcctcatcctcgacggccaccaccgcgtcgtcctccaccgccgctggcgtgcggtcgccagcgaagtcgaactcgttcgtgggcacggaggactacgtggcgccggagatcatcgccggcagcgggcacgacttctccgtggactggtggggcctgggcgtggtgctctacgagatgctctacggccgcacgccgttccgggggctgaacaggaaggagacgttctaccgcgtcctctccaagcagccggagctcgtcggcgagaagacgccgctgcgcgacctcatcgcccgcctcctggagaaggaccccgagaagcgcatcggcgcgcgcgggatcaaggcgcacccgttcttcaacggcgtcgactgggaccgcatcctccgcgtggcgcgcccgccgttcatcccgcccccgccggaggacgaggacgaggccggcgaggtgctcgacgtcgagaaggtcgtcaacgaggtgttcgcggccaatgacggcggggccgcagcgggtgtggtggagaagccttcgccggaggcaggtggaactctggccgtcggcgatggcgagcagaggagagatccgtccaaagaaggcgatttctccgtatttttctga</cdnaseq>|
 
AA = <aaseq>MAAAAMAPSPPEPALPRELSLGDLRAVSMLGRGAKGVVFHVVPA                    AAGEEEASMALKAVSREAARHKKNGSGGEDGHRRIWFERDVLMSLRHPLLPSLRGVLA                    TDAVVGFAIDRCGGGDLNSLRRRQTEKMFSDSVIRFYAAELVLALDYLHSLGIVYRDL                    KPENVLIQDSGHIMLVDFDLSTRLPTPPPPPEEQDATIADSMPEPPPSSPSPNRAKGK                    RQPGAASCFPFCSVGATKPAASADSPSPTSTSRTASASSSSSSSTATTASSSTAAGVR                    SPAKSNSFVGTEDYVAPEIIAGSGHDFSVDWWGLGVVLYEMLYGRTPFRGLNRKETFY                    RVLSKQPELVGEKTPLRDLIARLLEKDPEKRIGARGIKAHPFFNGVDWDRILRVARPP                    FIPPPPEDEDEAGEVLDVEKVVNEVFAANDGGAAAGVVEKPSPEAGGTLAVGDGEQRR                    DPSKEGDFSVFF</aaseq>|
 
DNA = <dnaseqindica>632..1610#109..518#tcgcgcaccgaccccactcggatcctctcctcccctcctcactgcctctctcccgtccacgagcggttggtcgatcgatcgatcgatcggcgcggtccttcgccagccatggcggcggcggcgatggcgccctcgcctccggagccggcgttgccgcgggagctcagcctgggggacctcagggcggtgtccatgctcggccggggcgccaagggcgtcgtgttccacgtcgtgcccgcggcggcgggggaggaggaggcctccatggcgctcaaggcggtctcgcgggaggcggcgcggcacaagaagaacgggagcggcggcgaggacgggcaccggcggatctggttcgagcgggacgtgctcatgtcgctgcgacacccgctgctcccctccctccgcggcgtcctcgccaccgacgccgtcgtcgggttcgccatcgaccgctgcggcggcggagacctcaactcgctccggcgccgccagaccgagaagatgttctccgactccgtcatccggtacgcttctcgcatcccccccgtttggccatcgccgcttctccgccacccacccgcgcacgaatgggttaactaaccacctcgccgttgttgattgttgcttctgattgcagcttctacgccgcggagttggtgctggcgctcgactatctgcacagcctcggcatcgtgtaccgcgacctcaagccggagaacgtcctgatacaggacagcggccacatcatgctcgtcgacttcgacctctccacgaggctcccgacgccgccgccgccaccggaggagcaggacgcaacgattgctgattccatgccggagcctccgcccagttcaccgtccccgaaccgcgcgaagggcaagaggcaaccgggggcggcctcgtgcttcccgttctgttcggtcggcgccacgaagccggccgcgtcggcggactcgccgtcgccaacgtccacctcgcgcacggcctcggcgtcgtcctcgtcctcatcctcgacggccaccaccgcgtcgtcctccaccgccgctggcgtgcggtcgccagcgaagtcgaactcgttcgtgggcacggaggactacgtggcgccggagatcatcgccggcagcgggcacgacttctccgtggactggtggggcctgggcgtggtgctctacgagatgctctacggccgcacgccgttccgggggctgaacaggaaggagacgttctaccgcgtcctctccaagcagccggagctcgtcggcgagaagacgccgctgcgcgacctcatcgcccgcctcctggagaaggaccccgagaagcgcatcggcgcgcgcgggatcaaggcgcacccgttcttcaacggcgtcgactgggaccgcatcctccgcgtggcgcgcccgccgttcatcccgcccccgccggaggacgaggacgaggccggcgaggtgctcgacgtcgagaaggtcgtcaacgaggtgttcgcggccaatgacggcggggccgcagcgggtgtggtggagaagccttcgccggaggcaggtggaactctggccgtcggcgatggcgagcagaggagagatccgtccaaagaaggcgatttctccgtatttttctgagcgtatttattgagttcttttttagcgttctctctcttaaaaatggaaaattacatagctattttggttttttctatggactagaattattatgggggtctctattagtaatagacataattaagacaaagtacggcgcggtggagtacataaatcgactttgctcttgtgtttaatggagtacagtctgtatagtatttttcccctttcccttttattttcttctttgttggatacatttccccgtgcaacgatgcaagctaggggattactgaagagtgtacataaggaatgatgaacagcaaaattggcctaatgttgtgtccatccatgtgttccatttcgctttgggtagccattgatgttaatacctgttacttcctttcagtgggagtaatagaaatggtcacggttttgtacatttttctgcaacattctctcaaagtagtaaatgctttgaagtgcccttgcgccatcaatgaggt</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001059689.1 RefSeq:Os04g0488700]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 07:05, 12 June 2015

The locus name of rice Os11g0523800 is AGC Kinase.Gene symbols are OsOxi1,Located on chromosome 4.

Annotated Information

Function

OsPti1a, a functional ortholog of tomato SlPti1, negatively regulates both basal resistance and R-gene-mediated resistance in rice. To investigate the molecular function of OsPti1a in defense responses, we searched for components interacting with OsPti1a using a yeast two-hybrid system. One of the interacting proteins is a Ser/Thr kinase that directly phosphorylates OsPti1a in vitro. This protein belongs to the AGC kinase family and is highly similar to AtOxi1, which is induced in response to a wide range of reactive oxygen species (ROS)-generating stimuli in Arabidopsis. Thus, it was designated OsOxi1. OsOxi1 was transiently phosphorylated in response to ROS and chitin elicitor. Both OsOxi1-overexpressing transgenic lines and the ospti1a mutant were highly sensitive to ROS treatment, indicating that OsOxi1 and OsPti1a are involved in ROS-mediated signaling in opposing ways.[1]The AGC kinase OsOxi1, which has been isolated as an interactor with OsPti1a, positively regulates basal disease resistance in rice. In eukaryotes, AGC kinase family proteins are regulated by 3-phosphoinositide-dependent protein kinase 1 (Pdk1). In Arabidopsis, AtPdk1 directly interacts with phosphatidic acid, which functions as a second messenger in both biotic and abiotic stress responses.[2]

Expression

OsOxi1 is specifically expressed at infection sites where ROS are produced after inoculation with a blast fungus, Magnaporthe oryzae. Overexpression of OsOxi1 enhanced basal resistance to the blast fungus, indicating that OsOxi1 positively regulates disease resistance. OsOxi1 phosphorylates Thr-233 of OsPti1a and a point mutation of Thr-233 enhanced disease susceptibility to a bacterial pathogen Xanthomonas oryzae pv. oryzae (Xoo), suggesting that the phosphorylation of OsPti1a by OsOxi1 is essential for basal resistance to Xoo. Taken together, our data suggest that OsOxi1 positively regulates defense responses through the phosphorylation of OsPti1a, causing the release from an OsPti1a-dependent inhibition of the responses.[1]The functions of Pdk1 are poorly understood in plants. We show here that OsPdk1 acts upstream of the OsOxi1–OsPti1a signal cascade in disease resistance in rice. OsPdk1 interacts with OsOxi1 and phosphorylates the Ser283 residue of OsOxi1 in vitro. To investigate whether OsPdk1 is involved in immunity that is triggered by microbial-associated molecular patterns, we analyzed the phosphorylation status of OsPdk1 in response to chitin elicitor. Like OsOxi1, OsPdk1 is rapidly phosphorylated in response to chitin elicitor, suggesting that OsPdk1 participates in signal transduction through pathogen recognition. The overexpression of OsPdk1 enhanced basal resistance against a blast fungus, Magnaporthe oryzae, and a bacterial pathogen, Xanthomonas oryzae pv. oryzae (Xoo). Taken together, these results suggest that OsPdk1 positively regulates basal disease resistance through the OsOxi1–OsPti1a phosphorylation cascade in rice.[2]

Evolution

Labs working on this gene

  • Division of Plant Sciences, National Institute of Agrobiological Sciences, Tsukuba, Ibaraki 305-8602, Japan.

References

  1. 1.0 1.1 Hidenori Matsui;Muneo Yamazaki;Mitsuko Kishi-Kaboshi;Akira Takahashi;Hirohiko Hirochika AGC Kinase OsOxi1 Positively Regulates Basal Resistance through Suppression of OsPti1a-Mediated Negative Regulation Plant and Cell Physiology, 2010, 51(10): 1731-1744.
  2. 2.0 2.1 Hidenori Matsui;Akio Miyao;Akira Takahashi;Hirohiko Hirochika Pdk1 Kinase Regulates Basal Disease Resistance Through the OsOxi1–OsPti1a Phosphorylation Cascade in Rice Plant and Cell Physiology, 2010, 51(12): 2082-2091.

Structured Information