Difference between revisions of "Os05g0245300"

From RiceWiki
Jump to: navigation, search
(Created page with "{{JaponicaGene| GeneName = Os05g0245300| Description = Protein of unknown function DUF588 family protein| Version = NM_001061549.1 GI:115462828 GeneID:4338204| Length = 20...")
 
(Annotated Information)
 
(5 intermediate revisions by 3 users not shown)
Line 1: Line 1:
{{JaponicaGene|
+
The rice '''Os05g0245300''' was reported as '''OsBLE3''' in 2006 <ref name="ref1" /> by researchers from the Japan.
GeneName = Os05g0245300|
+
<br>
Description = Protein of unknown function DUF588 family protein|
+
==Annotated Information==
Version = NM_001061549.1 GI:115462828 GeneID:4338204|
+
===Gene Symbol===
Length = 2054 bp|
+
*'''Os05g0245300 <=> OsBLE3'''
Definition = Oryza sativa Japonica Group Os05g0245300, complete gene.|
+
<br>
Source = Oryza sativa Japonica Group
+
===Function===
 +
*OsBLE3 is a brassinolide (BL) upregulated gene.  
 +
*OsBLE3 is involved in cell elongation in rice through dual regulation by BL and IAA.
 +
<br>
  
  ORGANISM  Oryza sativa Japonica Group
+
===Expression===
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
+
*OsBLE3 is mainly expressed in roots and leaf sheaths with levels of expression directly dependent on the dose of BL. In situ hybridization detected OsBLE3 mRNA in the shoot apical meristem, organ primordia and vascular tissue. Furthermore,its expression was enhanced by co-treatment with BL and low concentrations of IAA. These results, and the existence of auxin response elements in the 50-flanking region of the OsBLE3 gene, indicate that OsBLE3 expression is under control of both BR and auxin. The GUS reporter gene driven by a 2277 bp OsBLE3 putative promoter was mainly expressed in vascular tissues, branch root primordia and was responsive to exogenous BL treatment.  
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
+
<br>
            clade; Ehrhartoideae; Oryzeae; Oryza.
+
 
|
+
===Mutant===
Chromosome = [[:category:Japonica Chromosome 5|Chromosome 5]]|
+
*OsBLE3 transcript levels were greatly reduced in brd1 plants, a BL deficient mutant,compared to the wild type control. In OsBRI1 antisense transgenic rice and OsBLE3, the BR-insensitive mutant expression of OsBLE3 in response to exogenous BL treatment was significantly lower compared to that in control plants transformed with a vacant vector.Reduced OsBLE3 expression and growth retardation was also observed in OsBLE3 antisense transgenic rice plants. Internode cell length of the OsBLE3 antisense transgenic lines was about 70% of that in the vacant vector transformed control lines.  
AP = Chromosome 5:8857646..8859699|
+
<br>
CDS = 8857886..8858116,8859024..8859126,8859425..8859579|
+
 
GCID = <gbrowseImage1>
+
==Labs working on this gene==
name=NC_008398:8857646..8859699
+
*National Institute of Agrobiological Sciences, 2-1-2 Kannondai, Tsukuba 305-8602, Japan
source=RiceChromosome05
+
*BioScience and Biotechnology Center, Nagoya University, Chikusa, Nagoya 464-8601, Japan
preset=GeneLocation
+
*National Institute of Crop Science, 2-1-18 Kannondai, Tsukuba 305-8518, Japan
</gbrowseImage1>|
+
<br>
GSID = <gbrowseImage2>
+
==References==
name=NC_008398:8857646..8859699
+
<references>
source=RiceChromosome05
+
<ref name="ref1">
preset=GeneLocation
+
OsBLE3, a brassinolide-enhanced gene, is involved in the growth of rice
</gbrowseImage2>|
+
</references>
CDNA = <cdnaseq>atggcgaaggtgcaccggctgatgaacgccgtgctccggctcgccgctgcggcggctgctgcaacggcggcggtcgtcatggtgacgagccgtgagaccaccagcttcttcggcattcagatggaggccaagtactcctacaccccatcttttatcttcttcgtggtggcgtatgccgtggcggccgcgtatagcctgctcgtactggccgtgccggcagggagtgccctctccagattggcgctaacaacagatgtggtgttggggatggtgctcgccggtgccgtggcctccgccggcgccatatcggacatcgcgaagaacggcaactcgcacgccgggtggctgccggtgtgcgggcagatacacgcctactgcaaccacgtcatggcggcgctcatcgccggcttcgtcgcgctggccgtccacttcgtcgtcgtcatgtactccctccacattgtcaccgatgtcatttgcccctgccattag</cdnaseq>|
+
<br>
AA = <aaseq>MAKVHRLMNAVLRLAAAAAAATAAVVMVTSRETTSFFGIQMEAK                    YSYTPSFIFFVVAYAVAAAYSLLVLAVPAGSALSRLALTTDVVLGMVLAGAVASAGAI                    SDIAKNGNSHAGWLPVCGQIHAYCNHVMAALIAGFVALAVHFVVVMYSLHIVTDVICP                    CH</aaseq>|
+
==Structured Information==
DNA = <dnaseqindica>1584..1814#574..676#121..275#gcttatctaaaatcacacctgaatcttgccaaattaatgcctatttgtttctgatccctagctttaaaggctgaagctgctgtcagctgtgttcgcgcagcagcaagcacaggcagcatcatggcgaaggtgcaccggctgatgaacgccgtgctccggctcgccgctgcggcggctgctgcaacggcggcggtcgtcatggtgacgagccgtgagaccaccagcttcttcggcattcagatggaggccaagtactcctacaccccatcttttatgtaagtagaacatattacatatatatacatgttgttgattaactttgcctctgtacaaagttgtcaaaatctcaattctgtcatatgatttatgactttacgattctatttaaggtgcctgattctcctatcctacatatagaatctacgattttgtgatttttacgtatatgattctatgattatatatggtcctacttagaacatccgatttcgatttgagatcacgatttagcaacattgctccaatgccatcgtcggttgagttctctgcacgtactgttgtgttctgtggcagcttcttcgtggtggcgtatgccgtggcggccgcgtatagcctgctcgtactggccgtgccggcagggagtgccctctccagattggcgctaacaacagatgtggtactgtctcctctctgttttgtaaatttacttacaatattgtttgattccctcgtttcatcgattcattctaaacagcaagataatgaatgtccttcttttcggcattggactttccaatcaattaattgatggtaaaactcgtaaagatcaactttgcgaaaattccattgtatcctaggagcttgtaactcataactcattagaaaaacaaaaatgagattctatataataagttgttgatattcaataactcgtagaaaacaatcacaaaatctaaacatttattagtttatccataaggcgatcccgcaatacattatagccattttctaatcgaaatgatcaagaaagatgattcagtgttctctactagtagtattatactactagtaaaaatgatctgaaccgttcgttaccaagagtaaatcggtaatttactaatacagttattacgggtaactttgttatttatggttttccccggctaaatcgatatgtggtcattcattgtgttggtattgctcatattctatctaaaaagctaaaaaaagaagaaaaaaaaaggtttacccactactaaatgacgattatgtcccttcacactttttttttttttgacaataatgatcctcgacatttctactgccactatctaaggtgataatataaatagatacaaacccttcgatcaaatgagatcaacagtttataaattgttttctactacaagtagaaagcaccatactaggctcacattattccgtcttttaaaatgaccagatttatttatactaaattgcacggatgatcctaaagcttgtcgcatgcatggtatcatctggtaaaaaaaaagattgtagaaccagttttcgatcaatatttctccgtccgtccatgtacgcaggtgttggggatggtgctcgccggtgccgtggcctccgccggcgccatatcggacatcgcgaagaacggcaactcgcacgccgggtggctgccggtgtgcgggcagatacacgcctactgcaaccacgtcatggcggcgctcatcgccggcttcgtcgcgctggccgtccacttcgtcgtcgtcatgtactccctccacattgtcaccgatgtcatttgcccctgccattagcagagtctatctatatatatagtccatagtagcagtatatatataggtcgtgatatatacttccatcaccaaaaattcgggtacgtatataccattttattttctctatatctatgtctcaatttgttaaagttatgtttcagatggcaactacattgtgatctatggtcctctgtatcttgttgttacttgttacacacaagatttgaatgaaaaatacccccacgatgttccagaaac</dnaseqindica>|
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 5]]
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001061549.1 RefSeq:Os05g0245300]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 5]]
 
[[Category:Chromosome 5]]
 

Latest revision as of 07:52, 7 November 2016

The rice Os05g0245300 was reported as OsBLE3 in 2006 [1] by researchers from the Japan.

Annotated Information

Gene Symbol

  • Os05g0245300 <=> OsBLE3


Function

  • OsBLE3 is a brassinolide (BL) upregulated gene.
  • OsBLE3 is involved in cell elongation in rice through dual regulation by BL and IAA.


Expression

  • OsBLE3 is mainly expressed in roots and leaf sheaths with levels of expression directly dependent on the dose of BL. In situ hybridization detected OsBLE3 mRNA in the shoot apical meristem, organ primordia and vascular tissue. Furthermore,its expression was enhanced by co-treatment with BL and low concentrations of IAA. These results, and the existence of auxin response elements in the 50-flanking region of the OsBLE3 gene, indicate that OsBLE3 expression is under control of both BR and auxin. The GUS reporter gene driven by a 2277 bp OsBLE3 putative promoter was mainly expressed in vascular tissues, branch root primordia and was responsive to exogenous BL treatment.


Mutant

  • OsBLE3 transcript levels were greatly reduced in brd1 plants, a BL deficient mutant,compared to the wild type control. In OsBRI1 antisense transgenic rice and OsBLE3, the BR-insensitive mutant expression of OsBLE3 in response to exogenous BL treatment was significantly lower compared to that in control plants transformed with a vacant vector.Reduced OsBLE3 expression and growth retardation was also observed in OsBLE3 antisense transgenic rice plants. Internode cell length of the OsBLE3 antisense transgenic lines was about 70% of that in the vacant vector transformed control lines.


Labs working on this gene

  • National Institute of Agrobiological Sciences, 2-1-2 Kannondai, Tsukuba 305-8602, Japan
  • BioScience and Biotechnology Center, Nagoya University, Chikusa, Nagoya 464-8601, Japan
  • National Institute of Crop Science, 2-1-18 Kannondai, Tsukuba 305-8518, Japan


References

  1. Cite error: Invalid <ref> tag; no text was provided for refs named ref1


Structured Information