Difference between revisions of "Os02g0220400"

From RiceWiki
Jump to: navigation, search
(Structured Information)
 
(22 intermediate revisions by 5 users not shown)
Line 1: Line 1:
The CYTOKININ-RESPONSIVE GATA TRANSCRIPTION FACTOR1/GNC-like (''CGA1/GNL'') transcription factor was originally identified in Arabidopsis (At4g26150) due to rapidly increased expression following cytokinin application and similarity to a paralogous gene produced through genome duplication<ref name="1" /><ref name="2" /><ref name="3" /><ref name="4" />.
+
The CYTOKININ-RESPONSIVE GATA TRANSCRIPTION FACTOR1/GNC-like (''CGA1/GNL'') transcription factor is the cytokinin-responsive GATA transcription factor<ref name="p1" /><ref name="p2" /><ref name="p3" /><ref name="p4" />.
  
 
==Annotated Information==
 
==Annotated Information==
Line 5: Line 5:
 
===Function===
 
===Function===
  
Transgenic Arabidopsis plants with altered expression of ''CGA1'' have been shown to exhibit differences in germination, chlorophyll content, chloroplast number, leaf size, flowering time, and senescence<ref name="1" /><ref name="5" /><ref name="6" />. This includes recent reports showing that ectopic overexpression promotes chloroplast biogenesis in cells where they are not typically found. These data indicate that GNC and CGA1 function as key transcriptional regulators of chloroplast biogenesis in Arabidopsis.
+
The conserved GATA transcription factor Cga1 (Os02g12790) regulates chloroplast development and plant architecture. Strong overexpression of Cga1 produces dark green, semidwarf plants with reduced tillering, whereas RNA interference knockdown results in reduced chlorophyll and increased tillering. Coexpression, microarray, and real-time expression analyses demonstrate a correlation between Cga1 expression and the expression of important nucleus-encoded, chloroplast-localized genes. Constitutive Cga1 overexpression increases both chloroplast biogenesis and starch production but also results in delayed senescence and reduced grain filling<ref name="p7" />. It is one of transcription factors of the GATA family with a significant degree of conservation in the dicot model organism Arabidopsis<ref name="p1" />.
  
A new research demonstrates that the conserved GATA transcription factor Cga1 (Os02g12790) regulates chloroplast development and plant architecture in rice (Oryza sativa)<ref name="7" />.  
+
Transgenic Arabidopsis plants with altered expression of CGA1 have been shown to exhibit differences in germination, chlorophyll content, chloroplast number, leaf size, flowering time, senescence and chloroplast biogenesis in cells<ref name="p4" /><ref name="p5" /><ref name="p6" /><ref name="p8" /><ref name="p9" />.
  
 
===Mutations===
 
===Mutations===
Line 13: Line 13:
 
Transgenic rice with altered expression of Cga1 exhibits differences in chlorophyll, chloroplast number, and starch content, which has also been reported in Arabidopsis. However, we also observed a dosage-dependent influence on phenotype, with strong overexpression causing a semidwarf phenotype, similar to the GA mutant Green Revolution varieties (Figure1).  
 
Transgenic rice with altered expression of Cga1 exhibits differences in chlorophyll, chloroplast number, and starch content, which has also been reported in Arabidopsis. However, we also observed a dosage-dependent influence on phenotype, with strong overexpression causing a semidwarf phenotype, similar to the GA mutant Green Revolution varieties (Figure1).  
  
[[File:Figure1.jpg]]
+
[[File:Figure1lym.jpg]]
  
Figure 1. Transgenic modification to ''Cga1'' expression alters chlorophyll content and plant architecture<ref name="7" />.
+
Figure 1. Transgenic modification to ''Cga1'' expression alters chlorophyll content and plant architecture<ref name="p7" />.Transgenic modification to
 +
''Cga1'' expression alters chlorophyll content and plant architecture. A, Expression of ''Cga1'' in the selected transgenic lines compared with wild-type Kaybonnet controls (Wt-Kay) measured using qRT-PCR. B, Preflowering transgenic ''OsCga1'' lines at 60 d after germination exhibit differences in plant architecture. C, Chlorophyll at young (third leaf) and late (flag leaf) stages of development (n = 36+; *P < 0.05). D, Height of mature transgenic plants (n = 40; *P > 0.05). E, Mature transgenic plants (150 d after germination) compared with the wild type. F, Number of flowering tillers (n = 80; *P < 0.05).  
  
 
Novel evidence was presented that altering Cga1 expression in rice significantly influences tillering, biomass, and yield (Figure1, 2).  
 
Novel evidence was presented that altering Cga1 expression in rice significantly influences tillering, biomass, and yield (Figure1, 2).  
  
[[File:Figure2.jpg]]
+
[[File:Figure2lym.jpg]]
  
Figure 2. Cga1 expression influences starch content and grain production<ref name="7" />.
+
Figure 2. Cga1 expression influences starch content and grain production<ref name="p7" />.Cga1 expression influences starch content and grain production. A, Light microscopy of leaf blades showing fresh samples (right) and following IKI staining (left) for starch. B, Wax-embedded leaf tissue sections (12 μm) stained with IKI. C, Seed starch measured using the Megazyme Total Starch kit (Wilcoxon; n = 5–6; *P< 0.05). D, Seed mass (n = 100; *P> 0.05) and images of seeds produced from transgenic lines. E, Panicles from the primary tiller showing differences in architecture as well as delayed senescence of Cga1 overexpression lines compared with the wild-type Kaybonnet control (Wt-''Kay''). F, Panicle architecture and grain filling in the Cga1 transgenics compared with the wild type (n = 40+; *P< 0.05). All data are means±SD.
  
 
Changes are demonstrated in the expression of important nucleus-encoded, chloroplast-localized genes involved in chlorophyll binding, photosynthesis, and amino acid and starch biosynthesis in the Cga1 transgenics.  
 
Changes are demonstrated in the expression of important nucleus-encoded, chloroplast-localized genes involved in chlorophyll binding, photosynthesis, and amino acid and starch biosynthesis in the Cga1 transgenics.  
Line 35: Line 36:
 
The expression of Cga1 following a number of treatments was also analyzed. Differences in Cga1 expression throughout the course of the day was also observed. (Figure3B). Light was found to significantly increase Cga1 expression, whereas periods of darkness reduced expression (Figure3, B and C). Cga1 was highly upregulated (approximately 5-fold) by the synthetic cytokinin benzyladenine (BA; figure3C). Nitrate (NO3 -) also significantly increased Cga1 expression, although to a lesser extent than BA (Figure3C).
 
The expression of Cga1 following a number of treatments was also analyzed. Differences in Cga1 expression throughout the course of the day was also observed. (Figure3B). Light was found to significantly increase Cga1 expression, whereas periods of darkness reduced expression (Figure3, B and C). Cga1 was highly upregulated (approximately 5-fold) by the synthetic cytokinin benzyladenine (BA; figure3C). Nitrate (NO3 -) also significantly increased Cga1 expression, although to a lesser extent than BA (Figure3C).
  
[[File:Figure2.jpg]]
+
[[File:Figure3lym.jpg]]
 
 
Figure 3. Expression of rice ''Cga1''(Os02g12790)<ref name="7" />.
 
  
 +
Figure 3. Expression of rice ''Cga1''(Os02g12790)<ref name="p7" />.Expression of rice ''Cga1'' (Os02g12790). A, Expression of Cga1 in selected rice tissues. B, Expression of Cga1 at 6-h intervals throughout the course of the day (long day; 16 h of light). C, Real-time PCR of ''OsCga1'' expression levels following periods of darkness or light and following treatment with 10 mM nitrate, 10 ''μ''mol of BA cytokinin, or 10 ''μ''mol of GA3.
  
 
===Subcellular Localization===
 
===Subcellular Localization===
Line 48: Line 48:
 
Department of Molecular and Cellular Biology, University of Guelph, Guelph, Ontario, Canada
 
Department of Molecular and Cellular Biology, University of Guelph, Guelph, Ontario, Canada
  
Syngenta Biotechnology, Inc., Research Triangle Park,North Carolina
+
Syngenta Biotechnology, Inc., Research Triangle Park, North Carolina, America
 +
 
 +
Department of Molecular, Cellular and Developmental Biology, Yale University, New Haven, Connecticut, America
 +
 
 +
Department of Biological Sciences, Dartmouth College, Hanover, New Hampshire, America
 +
 
 +
Department of Biology, Colorado State University, Fort Collins, America
 +
 
 +
Department of Biology, University of North Carolina, Chapel Hill, North Carolina, America
 +
 
 +
Laboratory of Molecular Microbiology, School of Agriculture, Nagoya University, Japan
  
 
==References==
 
==References==
 
 
<references>
 
<references>
<ref name="1" />Reyes JC, Muro-Pastor MI, Florencio FJ (2004) The GATA family of transcription factors in Arabidopsis and rice. Plant Physiol 134: 1718–1732.   </ref>  
+
<ref name="p1"> Reyes JC, Muro-Pastor MI, Florencio FJ (2004) The GATA family of transcription factors in Arabidopsis and rice. Plant Physiol 134: 1718–1732.</ref>
 +
<ref name="p2"> Kiba T, Naitou T, Koizumi N, Yamashino T, Sakakibara H, Mizuno T (2005) Combinatorial microarray analysis revealing Arabidopsis genes implicated in cytokinin responses through the His→Asp phosphorelay circuitry. Plant Cell Physiol 46: 339–355. </ref>
 +
<ref name="p3"> Naito T, Kiba T, Koizumi N, Yamashino T, Mizuno T (2007) Characterization of a unique GATA family gene that responds to both light and cytokinin in
 +
Arabidopsis thaliana. Biosci Biotechnol Biochem 71: 1557–1560. </ref>
 +
<ref name="p4"> Mara CD, Irish VF (2008) Two GATA transcription factors are downstream effectors of floral homeotic gene action in Arabidopsis. Plant Physiol 147: 707–718. </ref>
 +
<ref name="p5"> Richter R, Behringer C, Müller IK, Schwechheimer C (2010) The GATAtype transcription factors GNC and GNL/CGA1 repress gibberellin signaling downstream from DELLA proteins and PHYTOCHROMEINTERACTING FACTORS. Genes Dev 24: 2093–2104. </ref>
 +
<ref name="p6"> Hudson D, Guevara D, Yaish MW, Hannam C, Long N, Clarke JD, Bi YM, Rothstein SJ (2011) GNC and CGA1 modulate chlorophyll biosynthesis and glutamate synthase (GLU1/Fd-GOGAT) expression in Arabidopsis. PLoS ONE 6: e26765. </ref>
 +
<ref name="p7"> Hudson, D., Guevara, D. R., Hand, A. J., Xu, Z., Hao, L., Chen, X., Zhu, T., Bi, Y. M., and Rothstein, S. J. (2013). Rice cytokinin GATA transcription Factor1 regulates chloroplast development and plant architecture. Plant physiology 162, 132-144. </ref>
 +
<ref name="p8">Köllmer I, Werner T, Schmülling T (2011) Ectopic expression of different cytokinin-regulated transcription factor genes of Arabidopsis thaliana alters plant growth and development. J Plant Physiol 168: 1320–1327. </ref>
 +
<ref name="p9">Chiang YH, Zubo YO, Tapken W, Kim HJ, Lavanway AM, Howard L, Pilon M, Kieber JJ, Schaller GE (2012) Functional characterization of the GATA transcription factors GNC and CGA1 reveals their key role in chloroplast development, growth, and division in Arabidopsis. Plant Physiol 160: 332–348. </ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os02g0220400|
 
Description = Similar to GATA transcription factor 16|
 
Version = NM_001052851.1 GI:115445072 GeneID:4328751|
 
Length = 1681 bp|
 
Definition = Oryza sativa Japonica Group Os02g0220400, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
 
AP = Chromosome 2:6734753..6736433|
 
CDS = 6734994..6735464,6735659..6736039,6736187..6736396|
 
GCID = <gbrowseImage1>
 
name=NC_008395:6734753..6736433
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008395:6734753..6736433
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atgtctactatctacatgagccagctacctgctactctccctctaatggagggggatcaggatcaggggctctacccagccttccatagagcaaaggaccctcctatcttgttccctttcatgatcgacagcgccgtcgagcaccaagggcaaatctatggagatcagggcttgaggaggcagcaggttttgggtgaatccaatcaacagttcaatgatcacatgatgatgggcggatcagatgtcttcctcacaccgtctccgttccgaccaaccatccaaagcatcggcagcgacatgatccagcgatcatcttatgatccatacgatatcgagagtaacaacaagcagcatgccaatggatcaaccagcaagtggatgtcgacgccgccaatgaagatgaggatcataaggaagggggcggcaaccgatcctgagggcggggcggtgagaaagccaaggagaagagcacaagcgcaccaggatgagagccagcaacaactgcagcaagctttgggtgtcgttagagtgtgctcggactgcaacaccaccaagacccccttgtggagaagtggtccttgtggccccaagtccctttgcaacgcgtgtggcatcaggcaaaggaaggcgcggcgggcgatggccgctgctgccaacggcggagcggcggtggcgccggcaaagagcgtggccgcggcgccggtgaacaataagccggcggcgaagaaggagaagagggcggcggacgtcgaccggtcgctgccgttcaagaaacggtgcaagatggtcgatcacgttgctgctgccgtcgctgccaccaagcccacggctgctggagaagtagtggccgccgctccgaaggaccaagatcacgtcatcgtcgtcggtggcgagaacgccgccgccacctccatgccggcacagaacccgatatccaaggcggcggcgaccgccgctgccgccgccgcctctccggcgttcttccacggcctccctcgcgacgagatcaccgacgccgccatgctgctcatgaccctatcctgtggcctcgtccacagctag</cdnaseq>|
 
AA = <aaseq>MSTIYMSQLPATLPLMEGDQDQGLYPAFHRAKDPPILFPFMIDS                    AVEHQGQIYGDQGLRRQQVLGESNQQFNDHMMMGGSDVFLTPSPFRPTIQSIGSDMIQ                    RSSYDPYDIESNNKQHANGSTSKWMSTPPMKMRIIRKGAATDPEGGAVRKPRRRAQAH                    QDESQQQLQQALGVVRVCSDCNTTKTPLWRSGPCGPKSLCNACGIRQRKARRAMAAAA                    NGGAAVAPAKSVAAAPVNNKPAAKKEKRAADVDRSLPFKKRCKMVDHVAAAVAATKPT                    AAGEVVAAAPKDQDHVIVVGGENAAATSMPAQNPISKAAATAAAAAASPAFFHGLPRD                    EITDAAMLLMTLSCGLVHS</aaseq>|
 
DNA = <dnaseqindica>970..1440#395..775#38..247#cttctctcccatctctttcctcctcctcctctctgatatgtctactatctacatgagccagctacctgctactctccctctaatggagggggatcaggatcaggggctctacccagccttccatagagcaaaggaccctcctatcttgttccctttcatgatcgacagcgccgtcgagcaccaagggcaaatctatggagatcagggcttgaggaggcagcaggttttgggtgaatccaatcaacaggtgaggggatcgatcacatacatgtgtagaacaagctagctacttatacacatgtagatcagtgcttctttcttagtatatatgctgcttgccctaataattttagcttatactcctcttctttttctcttttttttgctcttgcagttcaatgatcacatgatgatgggcggatcagatgtcttcctcacaccgtctccgttccgaccaaccatccaaagcatcggcagcgacatgatccagcgatcatcttatgatccatacgatatcgagagtaacaacaagcagcatgccaatggatcaaccagcaagtggatgtcgacgccgccaatgaagatgaggatcataaggaagggggcggcaaccgatcctgagggcggggcggtgagaaagccaaggagaagagcacaagcgcaccaggatgagagccagcaacaactgcagcaagctttgggtgtcgttagagtgtgctcggactgcaacaccaccaagacccccttgtggagaagtggtccttgtggccccaaggtgagatttacttgctcttacacccctattaacaactgcccaaactcatgtgttgatctgtctgtctgggtgctatatgctaccttactatgtgcattttctctttgttttgttacaccagatcatcatgcatatgttaaagattgttgatttccttggtttaaattgtgtgttgtgctatgcatatggtgcagtccctttgcaacgcgtgtggcatcaggcaaaggaaggcgcggcgggcgatggccgctgctgccaacggcggagcggcggtggcgccggcaaagagcgtggccgcggcgccggtgaacaataagccggcggcgaagaaggagaagagggcggcggacgtcgaccggtcgctgccgttcaagaaacggtgcaagatggtcgatcacgttgctgctgccgtcgctgccaccaagcccacggctgctggagaagtagtggccgccgctccgaaggaccaagatcacgtcatcgtcgtcggtggcgagaacgccgccgccacctccatgccggcacagaacccgatatccaaggcggcggcgaccgccgctgccgccgccgcctctccggcgttcttccacggcctccctcgcgacgagatcaccgacgccgccatgctgctcatgaccctatcctgtggcctcgtccacagctagctagctagctgatcaaaactagctagctactagtaccgttaatttgatgagggcaacaaccagagtactatgtaccactactagcaatattttgtgtgtgccttgtgatcttttgttgttttgtgttgttgaggagatcactagatcaggatgaaggagagatagtgatcacatgtctaaggacgaaataaacgagaacaaactcgctagctagctactagccgggatcaggattatattt</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001052851.1 RefSeq:Os02g0220400]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 05:36, 14 May 2015

The CYTOKININ-RESPONSIVE GATA TRANSCRIPTION FACTOR1/GNC-like (CGA1/GNL) transcription factor is the cytokinin-responsive GATA transcription factor[1][2][3][4].

Annotated Information

Function

The conserved GATA transcription factor Cga1 (Os02g12790) regulates chloroplast development and plant architecture. Strong overexpression of Cga1 produces dark green, semidwarf plants with reduced tillering, whereas RNA interference knockdown results in reduced chlorophyll and increased tillering. Coexpression, microarray, and real-time expression analyses demonstrate a correlation between Cga1 expression and the expression of important nucleus-encoded, chloroplast-localized genes. Constitutive Cga1 overexpression increases both chloroplast biogenesis and starch production but also results in delayed senescence and reduced grain filling[5]. It is one of transcription factors of the GATA family with a significant degree of conservation in the dicot model organism Arabidopsis[1].

Transgenic Arabidopsis plants with altered expression of CGA1 have been shown to exhibit differences in germination, chlorophyll content, chloroplast number, leaf size, flowering time, senescence and chloroplast biogenesis in cells[4][6][7][8][9].

Mutations

Transgenic rice with altered expression of Cga1 exhibits differences in chlorophyll, chloroplast number, and starch content, which has also been reported in Arabidopsis. However, we also observed a dosage-dependent influence on phenotype, with strong overexpression causing a semidwarf phenotype, similar to the GA mutant Green Revolution varieties (Figure1).

Figure1lym.jpg

Figure 1. Transgenic modification to Cga1 expression alters chlorophyll content and plant architecture[5].Transgenic modification to Cga1 expression alters chlorophyll content and plant architecture. A, Expression of Cga1 in the selected transgenic lines compared with wild-type Kaybonnet controls (Wt-Kay) measured using qRT-PCR. B, Preflowering transgenic OsCga1 lines at 60 d after germination exhibit differences in plant architecture. C, Chlorophyll at young (third leaf) and late (flag leaf) stages of development (n = 36+; *P < 0.05). D, Height of mature transgenic plants (n = 40; *P > 0.05). E, Mature transgenic plants (150 d after germination) compared with the wild type. F, Number of flowering tillers (n = 80; *P < 0.05).

Novel evidence was presented that altering Cga1 expression in rice significantly influences tillering, biomass, and yield (Figure1, 2).

Figure2lym.jpg

Figure 2. Cga1 expression influences starch content and grain production[5].Cga1 expression influences starch content and grain production. A, Light microscopy of leaf blades showing fresh samples (right) and following IKI staining (left) for starch. B, Wax-embedded leaf tissue sections (12 μm) stained with IKI. C, Seed starch measured using the Megazyme Total Starch kit (Wilcoxon; n = 5–6; *P< 0.05). D, Seed mass (n = 100; *P> 0.05) and images of seeds produced from transgenic lines. E, Panicles from the primary tiller showing differences in architecture as well as delayed senescence of Cga1 overexpression lines compared with the wild-type Kaybonnet control (Wt-Kay). F, Panicle architecture and grain filling in the Cga1 transgenics compared with the wild type (n = 40+; *P< 0.05). All data are means±SD.

Changes are demonstrated in the expression of important nucleus-encoded, chloroplast-localized genes involved in chlorophyll binding, photosynthesis, and amino acid and starch biosynthesis in the Cga1 transgenics.

Altering expression of the rice homolog to the FILAMENTOUS TEMPERATURE SENSITIVE-Z (FtsZ) gene involved in chloroplast division provides a potential mechanism for controlling chloroplast number.

Growing the transgenic lines under different N conditions indicates that Cga1 is able to maintain chloroplast development under reduced N conditions, leading to an increased harvest index despite reduced plant size.

Expression

Rice tissues and patterns of expression for Cga1 were analyzed and established in wild-type Kaybonnet rice. Cga1 exhibited the strongest expression in green leaf tissue, with little and no expression in roots and floral organs, respectively (Figure3A).

The expression of Cga1 following a number of treatments was also analyzed. Differences in Cga1 expression throughout the course of the day was also observed. (Figure3B). Light was found to significantly increase Cga1 expression, whereas periods of darkness reduced expression (Figure3, B and C). Cga1 was highly upregulated (approximately 5-fold) by the synthetic cytokinin benzyladenine (BA; figure3C). Nitrate (NO3 -) also significantly increased Cga1 expression, although to a lesser extent than BA (Figure3C).

Figure3lym.jpg

Figure 3. Expression of rice Cga1(Os02g12790)[5].Expression of rice Cga1 (Os02g12790). A, Expression of Cga1 in selected rice tissues. B, Expression of Cga1 at 6-h intervals throughout the course of the day (long day; 16 h of light). C, Real-time PCR of OsCga1 expression levels following periods of darkness or light and following treatment with 10 mM nitrate, 10 μmol of BA cytokinin, or 10 μmol of GA3.

Subcellular Localization

Nucleus

Labs working on this gene

Department of Molecular and Cellular Biology, University of Guelph, Guelph, Ontario, Canada

Syngenta Biotechnology, Inc., Research Triangle Park, North Carolina, America

Department of Molecular, Cellular and Developmental Biology, Yale University, New Haven, Connecticut, America

Department of Biological Sciences, Dartmouth College, Hanover, New Hampshire, America

Department of Biology, Colorado State University, Fort Collins, America

Department of Biology, University of North Carolina, Chapel Hill, North Carolina, America

Laboratory of Molecular Microbiology, School of Agriculture, Nagoya University, Japan

References

  1. 1.0 1.1 Reyes JC, Muro-Pastor MI, Florencio FJ (2004) The GATA family of transcription factors in Arabidopsis and rice. Plant Physiol 134: 1718–1732.
  2. Kiba T, Naitou T, Koizumi N, Yamashino T, Sakakibara H, Mizuno T (2005) Combinatorial microarray analysis revealing Arabidopsis genes implicated in cytokinin responses through the His→Asp phosphorelay circuitry. Plant Cell Physiol 46: 339–355.
  3. Naito T, Kiba T, Koizumi N, Yamashino T, Mizuno T (2007) Characterization of a unique GATA family gene that responds to both light and cytokinin in Arabidopsis thaliana. Biosci Biotechnol Biochem 71: 1557–1560.
  4. 4.0 4.1 Mara CD, Irish VF (2008) Two GATA transcription factors are downstream effectors of floral homeotic gene action in Arabidopsis. Plant Physiol 147: 707–718.
  5. 5.0 5.1 5.2 5.3 Hudson, D., Guevara, D. R., Hand, A. J., Xu, Z., Hao, L., Chen, X., Zhu, T., Bi, Y. M., and Rothstein, S. J. (2013). Rice cytokinin GATA transcription Factor1 regulates chloroplast development and plant architecture. Plant physiology 162, 132-144.
  6. Richter R, Behringer C, Müller IK, Schwechheimer C (2010) The GATAtype transcription factors GNC and GNL/CGA1 repress gibberellin signaling downstream from DELLA proteins and PHYTOCHROMEINTERACTING FACTORS. Genes Dev 24: 2093–2104.
  7. Hudson D, Guevara D, Yaish MW, Hannam C, Long N, Clarke JD, Bi YM, Rothstein SJ (2011) GNC and CGA1 modulate chlorophyll biosynthesis and glutamate synthase (GLU1/Fd-GOGAT) expression in Arabidopsis. PLoS ONE 6: e26765.
  8. Köllmer I, Werner T, Schmülling T (2011) Ectopic expression of different cytokinin-regulated transcription factor genes of Arabidopsis thaliana alters plant growth and development. J Plant Physiol 168: 1320–1327.
  9. Chiang YH, Zubo YO, Tapken W, Kim HJ, Lavanway AM, Howard L, Pilon M, Kieber JJ, Schaller GE (2012) Functional characterization of the GATA transcription factors GNC and CGA1 reveals their key role in chloroplast development, growth, and division in Arabidopsis. Plant Physiol 160: 332–348.

Structured Information