Difference between revisions of "AY986492"
Jiafuxiong (talk | contribs) (→Function) |
|||
| (7 intermediate revisions by 2 users not shown) | |||
| Line 5: | Line 5: | ||
===Expression=== | ===Expression=== | ||
The Xa27(t) locus conferred a high level of resistance to 27 strains and moderate resistance to three strains. Resistance of the Xa27(t) gene was developmentally regulated in IRBB27 and showed semidominant or a dosage effect in the cv. CO39 genetic background. As a prelude to cloning Xa27(t), a molecular mapping strategy was employed with a large mapping population consisting of 3,875 gametes | The Xa27(t) locus conferred a high level of resistance to 27 strains and moderate resistance to three strains. Resistance of the Xa27(t) gene was developmentally regulated in IRBB27 and showed semidominant or a dosage effect in the cv. CO39 genetic background. As a prelude to cloning Xa27(t), a molecular mapping strategy was employed with a large mapping population consisting of 3,875 gametes | ||
| + | |||
| + | ===Evolution=== | ||
| + | Induction of Xa27 occurs only in the immediate vicinity of infected tissue, whereas ectopic expression of Xa27 resulted in resistance to otherwise compatible strains of the pathogen. Thus Xa27 specificity towards incompatible pathogens involves the differential expression of the R gene in the presence of the AvrXa27 effector. | ||
| + | |||
| + | ==Structured Information== | ||
| + | {{IndicaGene| | ||
| + | GeneName = AY986492| | ||
| + | Description = 2361 bp DNA linear PLN 24-JUN-2005.| | ||
| + | Version = AY986492.1 GI:66735943| | ||
| + | Length = 2361 bp| | ||
| + | Definition = Oryza sativa (indica cultivar-group) Xa27 (Xa27) gene, Xa27-IRBB27 | ||
| + | allele, complete cds.| | ||
| + | Source = Oryza sativa Indica Group | ||
| + | |||
| + | ORGANISM Oryza sativa Indica Group | ||
| + | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; | ||
| + | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP | ||
| + | clade; Ehrhartoideae; Oryzeae; Oryza. | ||
| + | | | ||
| + | Chromosome = [[:category:Indica Chromosome 6|Chromosome 6]]| | ||
| + | AP = Chromosome 6:1558..1899| | ||
| + | CDS = 1558..1899| | ||
| + | AA = <aaseq>MADWAMHHYLLLANQQRHRALADVAVRRRQLLLDSGRVFMLLGA | ||
| + | VILMHMLTTTGGGASSGCTRGAEPCVALLLWLLGAALAMLSLVAGRFPVLAAAIAEEL | ||
| + | GDHLLGGLWSL</aaseq>| | ||
| + | DNA = <dnaseqindica>1..61#121..181#241..301#361..421# 481..541#601..661#721..781#841..901#961..1021#1081..1141#1201..1261#1321..1381#1441..1501#1561..1621#1681..1741#1801..1861#1921..1981#2041..2101#2161..2221#2281..2341# ctgcagctga accaaacagt tttagctcca tcgaagaaag gagttatact gattggaatgctctcacagt aaaaaaaaca aggaagtaga gctggatttt agacagttct acaagaagtt agaactctac caaaattgga attttggatg atggtctttt aaaaactcga ttgcaggaat aaaattttac ggcttgaaac ttacaaaatg attagaaaag ataacatgcc tcagcgattt gtaaaaaagt gaacaaataa aaatctacaa taccactaaa ctattgcttt attttgggga cattgcttac cattgaaaaa acaactaacc gtaaatacga acacccatat caaatatact atcactgata aaataatcaa ttgtaaattc aagcacacat attagtatag tactttaact cgattggata gaagaaacct aactaattta agctatgcct cacaacaaaa aggtataaat tttttaaggc ttcttttttt ttcttgcgtt tgctagttta tgcttttaag atgtttatac cttttactcc cctcattcac tgtttaaata caatgggaat tagtgaaatc aatgagagtt caaacttcga aacactgaat acatgttatt ttggattgaa atcaaatcga atcagtcaaa ttcaaatagg aggaggaaca taggcattct tcctttcttc agcgggcacc attgaattca gatactgctt cgcctagtct ctgtccaaga ctccacattt tctgatggtg atggggaact ctgaaactat aggaggaaga ataaaatgaa gaatgcagaa atgaatagta atttgtgttt tttaattctt cttcaattcc accttaggat ccaacttcag tccaaatcca aagtaatgca actgccacta gatcaggcta gagcttcaaa ttcaactcca aaaacctccg taaagtggca cacacagagg aaaaatcctg gattcgtcac tgcccatcaa catctgcttt cgcctcccaa ttcctgcttt ctgaaatctg ctttcgccga attcatgcct tcttgaatta tgctttctta gaccctcttt agatgggact aaaactttta ctctctatca catcggatgt ttggacacta attataaata ttaaacgtag actattaata aaacccatct ataatcttgt attaattcgc gagacgaatc tattgagcct aattaatcca tgattagcct atgtgatgct ataataaaca ttctctaatt ataaattaat tgggcttaaa aaatttgtct cgcgtattag ctttcattta tataattagt tttataaata gtctatattt aatactctaa attagtgtct aaatacaggg actaaagtta agtcactgga tccaaacacc acctaaggtt ttcttgtgta cttgtgaatt gtggttgact acgactacta gtgctataaa tagaagaaga gacccataga gagcatcaga gcaaagtact cctaaaagac agccacacac actgagacac ccaagaagct gcctccaatg gcggattggg cgatgcacca ctacctccta ctagccaacc agcaacgcca ccgagccctc gccgacgtcg ccgtccgccg ccgccagctg ctcctcgact ccggccgcgt cttcatgctc ctcggcgccg tcatcctcat gcacatgctc accactaccg gcggcggagc atcgtccggc tgcacccgcg gcgccgaacc ttgcgtcgcc ctcctcctgt ggctgctcgg cgcggcgctc gccatgctgt cgctcgtcgc cggccgattc cccgttctcg ctgccgccat tgctgaggag ctcggtgatc acctgcttgg tggtctctgg tctctctagt tctcctccgt gtccggtggt catcttcttc tccgtgcttt tgctctggag ttgagtacgg atctgtgtgt actgcattct tgcttaatta gtgccctaca cgttatgctt tcgaaacatc atcttttttc agtatagttc aataaatttc agctcaaatt tgtcctccaa gacgagttct ccatccaaac gaaacttatg | ||
| + | gtgttccgtt gtttgggccg attttatatg ttggaaatgt acagacttca tagtactgtg tttctttttt ggaataagtt caccagaggt tccttaactt aacggcgata tttttttagg tcctttaacc acaaaaccag aaatgtgcac ccctaaactt tcacaatccg tgcacaagag gtcctatggc agtatacgtg ggtggtttcg ctgacgtgac atcctagtca gcaaaaataa ataaataagt aagtggggcc c</dnaseqindica>| | ||
| + | Link = [http://www.ncbi.nlm.nih.gov/nuccore/66735943]| | ||
| + | }} | ||
| + | ==Labs working on this gene== | ||
| + | 1. Temasek Life Sciences Laboratory, National University of Singapore, Singapore, 117604, Singapore | ||
| + | |||
| + | 2. Rice Research Institute, Anhui Academy of Agricultural Sciences, Hefei, 230031, Anhui, China | ||
| + | |||
| + | 2. Rice Research Institute, Anhui Academy of Agricultural Sciences, Hefei, 230031, Anhui, China | ||
| + | |||
| + | |||
| + | ==References== | ||
| + | 1. Yanchang Luo;Jatinder S. Sangha;Shouhai Wang;Zefu Li;Jianbo Yang;Zhongchao Yin | ||
| + | Marker-assisted breeding of Xa4, Xa21 and Xa27 in the restorer lines of hybrid rice for broad-spectrum and enhanced disease resistance to bacterial blight | ||
| + | Molecular Breeding, 2012, 30(4): 1601-1610 | ||
| + | 2. Keyu Gu;Bing Yang;Dongsheng Tian;Lifang Wu;Dongjiang Wang;Chellamma Sreekala;Fan Yang;Zhaoqing Chu;Guo-Liang Wang;Frank F. White;Zhongchao Yin | ||
| + | R gene expression induced by a type-III effector triggers disease resistance in rice | ||
| + | Nature, 2005, 435: 1122-1125 | ||
| + | 3. K.Gu;D.Tian;F.Yang;L.Wu;C.Sreekala;D.Wang;G.-L.Wang;Z.Yin | ||
| + | High-resolution genetic mapping of Xa27(t), a new bacterial blight resistance gene in rice, Oryza sativa L. | ||
| + | Theoretical and Applied Genetics, 2004, 108(5): 800-807 | ||
| + | 4.Transfer of bacterial blight and blast resistance from the tetraploid wild rice Oryza minuta to cultivated rice, Oryza sativa | ||
| + | Theoretical and Applied Genetics, 1992, 84(3-4): 345-354 | ||
Latest revision as of 13:12, 10 June 2014
Contents
Function
Resistant and susceptible alleles of Xa27 encode identical proteins. However, expression of only the resistant allele occurs when a rice plant is challenged by bacteria harbouring avrXa27, whose product is a nuclear localized type-III effector. Induction of Xa27 occurs only in the immediate vicinity of infected tissue, whereas ectopic expression of Xa27 resulted in resistance to otherwise compatible strains of the pathogen. Thus Xa27 specificity towards incompatible pathogens involves the differential expression of the R gene in the presence of the AvrXa27 effector.
Expression
The Xa27(t) locus conferred a high level of resistance to 27 strains and moderate resistance to three strains. Resistance of the Xa27(t) gene was developmentally regulated in IRBB27 and showed semidominant or a dosage effect in the cv. CO39 genetic background. As a prelude to cloning Xa27(t), a molecular mapping strategy was employed with a large mapping population consisting of 3,875 gametes
Evolution
Induction of Xa27 occurs only in the immediate vicinity of infected tissue, whereas ectopic expression of Xa27 resulted in resistance to otherwise compatible strains of the pathogen. Thus Xa27 specificity towards incompatible pathogens involves the differential expression of the R gene in the presence of the AvrXa27 effector.
Structured Information
| Gene Name |
AY986492 |
|---|---|
| Description |
2361 bp DNA linear PLN 24-JUN-2005. |
| Definition |
Oryza sativa (indica cultivar-group) Xa27 (Xa27) gene, Xa27-IRBB27 allele, complete cds. |
| LocusTag |
{{{tag}}} |
| Ensembl Transcript ID |
{{{tid}}} |
| Ensembl Protein ID |
{{{pid}}} |
| Length |
2361 bp |
| Source |
Oryza sativa Indica Group ORGANISM Oryza sativa Indica Group Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 6:1558..1899 |
| Sequence Coding Region |
1558..1899 |
| Genome Context |
{{{GCID}}} |
| Gene Structure |
{{{GSID}}} |
| Coding Sequence |
{{{CDNA}}} |
| Protein Sequence |
<aaseq>MADWAMHHYLLLANQQRHRALADVAVRRRQLLLDSGRVFMLLGA VILMHMLTTTGGGASSGCTRGAEPCVALLLWLLGAALAMLSLVAGRFPVLAAAIAEEL
GDHLLGGLWSL</aaseq>
|
| Gene Sequence |
<dnaseqindica>1..61#121..181#241..301#361..421# 481..541#601..661#721..781#841..901#961..1021#1081..1141#1201..1261#1321..1381#1441..1501#1561..1621#1681..1741#1801..1861#1921..1981#2041..2101#2161..2221#2281..2341# ctgcagctga accaaacagt tttagctcca tcgaagaaag gagttatact gattggaatgctctcacagt aaaaaaaaca aggaagtaga gctggatttt agacagttct acaagaagtt agaactctac caaaattgga attttggatg atggtctttt aaaaactcga ttgcaggaat aaaattttac ggcttgaaac ttacaaaatg attagaaaag ataacatgcc tcagcgattt gtaaaaaagt gaacaaataa aaatctacaa taccactaaa ctattgcttt attttgggga cattgcttac cattgaaaaa acaactaacc gtaaatacga acacccatat caaatatact atcactgata aaataatcaa ttgtaaattc aagcacacat attagtatag tactttaact cgattggata gaagaaacct aactaattta agctatgcct cacaacaaaa aggtataaat tttttaaggc ttcttttttt ttcttgcgtt tgctagttta tgcttttaag atgtttatac cttttactcc cctcattcac tgtttaaata caatgggaat tagtgaaatc aatgagagtt caaacttcga aacactgaat acatgttatt ttggattgaa atcaaatcga atcagtcaaa ttcaaatagg aggaggaaca taggcattct tcctttcttc agcgggcacc attgaattca gatactgctt cgcctagtct ctgtccaaga ctccacattt tctgatggtg atggggaact ctgaaactat aggaggaaga ataaaatgaa gaatgcagaa atgaatagta atttgtgttt tttaattctt cttcaattcc accttaggat ccaacttcag tccaaatcca aagtaatgca actgccacta gatcaggcta gagcttcaaa ttcaactcca aaaacctccg taaagtggca cacacagagg aaaaatcctg gattcgtcac tgcccatcaa catctgcttt cgcctcccaa ttcctgcttt ctgaaatctg ctttcgccga attcatgcct tcttgaatta tgctttctta gaccctcttt agatgggact aaaactttta ctctctatca catcggatgt ttggacacta attataaata ttaaacgtag actattaata aaacccatct ataatcttgt attaattcgc gagacgaatc tattgagcct aattaatcca tgattagcct atgtgatgct ataataaaca ttctctaatt ataaattaat tgggcttaaa aaatttgtct cgcgtattag ctttcattta tataattagt tttataaata gtctatattt aatactctaa attagtgtct aaatacaggg actaaagtta agtcactgga tccaaacacc acctaaggtt ttcttgtgta cttgtgaatt gtggttgact acgactacta gtgctataaa tagaagaaga gacccataga gagcatcaga gcaaagtact cctaaaagac agccacacac actgagacac ccaagaagct gcctccaatg gcggattggg cgatgcacca ctacctccta ctagccaacc agcaacgcca ccgagccctc gccgacgtcg ccgtccgccg ccgccagctg ctcctcgact ccggccgcgt cttcatgctc ctcggcgccg tcatcctcat gcacatgctc accactaccg gcggcggagc atcgtccggc tgcacccgcg gcgccgaacc ttgcgtcgcc ctcctcctgt ggctgctcgg cgcggcgctc gccatgctgt cgctcgtcgc cggccgattc cccgttctcg ctgccgccat tgctgaggag ctcggtgatc acctgcttgg tggtctctgg tctctctagt tctcctccgt gtccggtggt catcttcttc tccgtgcttt tgctctggag ttgagtacgg atctgtgtgt actgcattct tgcttaatta gtgccctaca cgttatgctt tcgaaacatc atcttttttc agtatagttc aataaatttc agctcaaatt tgtcctccaa gacgagttct ccatccaaac gaaacttatg gtgttccgtt gtttgggccg attttatatg ttggaaatgt acagacttca tagtactgtg tttctttttt ggaataagtt caccagaggt tccttaactt aacggcgata tttttttagg tcctttaacc acaaaaccag aaatgtgcac ccctaaactt tcacaatccg tgcacaagag gtcctatggc agtatacgtg ggtggtttcg ctgacgtgac atcctagtca gcaaaaataa ataaataagt aagtggggcc c</dnaseqindica> |
| External Link(s) |
Labs working on this gene
1. Temasek Life Sciences Laboratory, National University of Singapore, Singapore, 117604, Singapore
2. Rice Research Institute, Anhui Academy of Agricultural Sciences, Hefei, 230031, Anhui, China
2. Rice Research Institute, Anhui Academy of Agricultural Sciences, Hefei, 230031, Anhui, China
References
1. Yanchang Luo;Jatinder S. Sangha;Shouhai Wang;Zefu Li;Jianbo Yang;Zhongchao Yin
Marker-assisted breeding of Xa4, Xa21 and Xa27 in the restorer lines of hybrid rice for broad-spectrum and enhanced disease resistance to bacterial blight Molecular Breeding, 2012, 30(4): 1601-1610
2. Keyu Gu;Bing Yang;Dongsheng Tian;Lifang Wu;Dongjiang Wang;Chellamma Sreekala;Fan Yang;Zhaoqing Chu;Guo-Liang Wang;Frank F. White;Zhongchao Yin
R gene expression induced by a type-III effector triggers disease resistance in rice Nature, 2005, 435: 1122-1125
3. K.Gu;D.Tian;F.Yang;L.Wu;C.Sreekala;D.Wang;G.-L.Wang;Z.Yin
High-resolution genetic mapping of Xa27(t), a new bacterial blight resistance gene in rice, Oryza sativa L. Theoretical and Applied Genetics, 2004, 108(5): 800-807
4.Transfer of bacterial blight and blast resistance from the tetraploid wild rice Oryza minuta to cultivated rice, Oryza sativa
Theoretical and Applied Genetics, 1992, 84(3-4): 345-354