Difference between revisions of "Os01g0797600"

From RiceWiki
Jump to: navigation, search
(Expression)
(Function)
 
(17 intermediate revisions by 2 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os01g0797600''''' was reported as '''''AP37''''' in 2009 <ref name="ref1" /> by researchers from Korea.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os01g0797600''''' '''''<=>''''' '''''AP37, OsAP37, OsERF3, OsERF#075, OsERF075, OsERF75, ERF75, AP2/EREBP#004, AP2/EREBP4, OsBIERF2, BIERF2'''''
 +
 
===Function===
 
===Function===
*OsERF3 (Os01g0797600), is AP2 domain-containing protein, it is found to be significantly up-regulated in both genotypes under cold stress.<ref name="ref1" />
+
*'''''AP37''''' (Os01g0797600), is AP2 domain-containing protein, it is found to be significantly up-regulated in both genotypes under cold stress.<ref name="ref1" />
*OsERF3 (Os01g0797600) belongs to class II ERFs with a conserved EAR-motif (DLNRPPP) at the C terminal (Nakano et al. 2006). In rice, OsERF3 participated in the resistance to disease and the herbivore-induced defense responses via mediating different hormone pathways (Luet al. 2011).We also found that OsERF3 negatively
+
*'''''AP37''''' gene has the potential to improve drought tolerance in rice without causing undesirable growth phenotypes.
affected ethylene production and drought tolerance in rice(Wan et al. 2011). However, little is known about whether its EAR motif is involved in the regulation of ethylene synthesis and drought response. Here, we generated transgenic rice overexpressing full-length (OE) and the mutation of OsERF3 with the A680/C substitution (mEAR), respectively. The phenotypic analyses suggested that mEAR lines showed better drought tolerance and more ethylene emission than those of OE lines and wild type (WT) plants. At the transcriptional level, the substitution of Leu/Ala disrupted the repression of ACO2 and ACS6 by OsERF3 in mEAR lines. Moreover, ACS2 was significantly up-regulated in mEAR lines compared with that in WT plants. Taken together, our results indicate that the EAR motif is required for OsERF3 to repress the expression of ethylene biosynthesis genes, deepening our understanding of the regulatory function of ERF proteins involved in ethylene biosynthesis and stress response.<ref name="ref2" />
 
*OsERF3 is a transcriptional repressor with an ethylene-responsive element-binding factor-associated amphiphilic repression (EAR) motif (F/LDLNxxP), which transcriptionally represses the ethylene emission and drought tolerance in rice. However, its molecular mechanism to explore repression function remains unknown.<ref name="ref2" />
 
  
 
===Expression===
 
===Expression===
*The expression of OsERF3 was induced by drought, salt, ACC and ABA treatment. In addition, it showed a higher expression level in the root and sheath than that in the leaf.
+
* The overexpression of '''''AP37''''' and '''''AP59''''' in rice under the control of the constitutive promoter OsCc1 increased the tolerance to drought and high salinity at the vegetative stage.  
*The full length of OsERF3 gene was obtained from the cDNA library using specific primers.The full length of OsERF3 gene was obtained from the cDNA library using specific primers. The mutation of EAR motif of OsERF3 (mEAR) was obtained by replacing the base of A680 with C (Fig. 1a) through PCR amplifications using specific primers (Table S1). Then, the full-length cDNA of OsERF3 and mEAR were inserted into pCAMBIA1307 modified from pCAMBIA1300, respectively. For the modification of pCAMBIA1307 vector (Fig. S1), we inserted a fragment including a CaMV 35S promoter and multiple cloning sites from vector pBluescript into the SstI and KpnI of pCAMBIA1300 vector. To generate the ERF3:GUS construct, the 1.0 kb promoter region upstream to start codon of OsERF3 was amplified using specific primers (OsERF3P-F and OsERF3P-R) (Table S1). Then, the fragment digested with EcoRI and NcoI was cloned into the multiple cloning sites of pCAMBIA1391Z vector. All of the transgenic rice plants were generated through Agrobacterium-mediated transformation. T1 seedlings were examined by PCR amplifications at the DNA and RNA levels with specific primers (Table S1); T2 and T3 seeds were screened by germinating with the selection of 50 ng/l hygromycin.
+
* Increased tolerance to low temperatures was observed only in OsCc1:AP37 plants. More importantly, the OsCc1:AP37 plants showed significantly enhanced drought tolerance in the field, which increased grain yield by 16% to 57% over controls under severe drought conditions, yet exhibited no significant difference under normal growth conditions.  
[[File:zch.png|200px|thumb|left|Fig. 1. Comparison of EAR motif and phylogenetic analysis of EAR motif containing ERF proteins from rice and Arabidopsis.]]
+
* In contrast, grain yield in OsCc1:AP59 plants in the field was reduced by 23% to 43% compared with controls under both normal and drought stress conditions.  
*The expression of OsERF3 was highly induced by ABA at 1 h, and reached peak at 2 h. Similarly, it was rapidly inducible by ACC at 0.5 h and peaked at 2 h, and then it decreased to normal level at 8 h (Fig. 2a). Moreover, OsERF3 was up-regulated by drought and peaked at 2 h. Similarly, OsERF3 was quickly induced by high salinity and peaked at 0.5 h. These results indicate that OsERF3 might be associated with ethylene- and ABArelated environmental stimuli in rice.the potential cis-elements withinthe 1 kb region (1,040 bp) upstream to the start codon(Table S2). There were more important elements involved in different hormones or stress signaling (including ethylene, ABA, Auxin and GA as well as dehydration, cold and light) and specific tissues. These data also support the molecular cues for the expression of OsERF3 in response to different hormones and stress treatments.
+
* Microarray experiments identified 10 and 38 genes that are up-regulated by AP37 and AP59, respectively, in addition to 37 genes that are commonly induced by both factors.
*As shown in Fig. 2b, the expression of OsERF3 in the root and sheath was two and three times higher than that in the leaf at the seedling phase, respectively. Moreover, the expression of GUS driven by the promoter of OsERF3 in transgenic rice was analyzed. Consistently, the GUS staining was observed in all parts of seedlings, but it showed more intense in sheath and root than that in leaf(Fig. 2c), further confirming its expression in seedlings.
 
[[File:zch2.png|400px|thumb|right|Fig. 2.Expression of OsERF3 .]]
 
 
 
===Mutation===
 
*The physiological analysesransgenic of rice overexpressing full-length OsERF3 (OE) and its mutation of EAR motif with the A680/C substitution (mEAR),  showed that mEAR lines showed better drought tolerance and more ethylene emission compared with those of OE lines and wild type plants.However, the repression of OsERF3 was eliminated in mEAR lines. Specifically, ACS2 was up-regulated in mEAR lines compared with that in OE lines andWTplants, suggesting that the Leu/Ala substitution
 
within the EAR motif resulted in loss of repression of OsERF3.theEARmotif is required for OsERF3 to transcriptionally regulate the ethylene synthesis and drought tolerance in rice, providing new insight to the roles of ethylene-response factor proteins in regulating ethylene biosynthesis and stress response.
 
*It has been reported that series stress-related genes (Luet al. 2011) and ethylene synthesis-related genes were regulated by OsERF3 in rice (Wan et al. 2011). In the present work, we focused on whether EAR motif is required for the repression of OsACS2, OsACS6, and OsACO2 by OsERF3 in rice. The expression level of these
 
genes in OE and mEAR lines was analyzed. As shown in Fig. 5, the expression level of ACO2, ACS2, and ACS6 was decreased in OE lines. Interestingly, the expression of
 
ACS2 in mEAR lines was much higher than that in WT; the expression level of ACO2 and ACS6 in mEAR lines showed similar to that in WT. These results revealed that the mutation of Leu227/Ala within the EAR motif disrupted the repression function of OsERF3, implying that the EAR motif is essential for OsERF3 to repress the expression of ACO2, ACS2, and ACS6 in rice.
 
[[File:zch4.png|300px|thumb|left|Fig. 4. Transcriptional repression of OsERF3 in the expression of ethylene biosynthesis-related genes via EAR motif.]]
 
 
 
===Evolution===
 
Compared the drought tolerance among the transgenic lines (OE and mEAR) and wild type (WT) Nipponbare. As shown in Fig. 3a, most of the OE seedling leaves turned withered after the 2-week-old seedlings were exposed to successive drought by withholding water for 6 days, while WT and mEAR lines still grew well. When the seedlings of WT and OE lines exhibited serious stress symptom at the eighth day, mEAR lines showed mild stress symptom (Fig. 3a). After treated for 9 days, the resulting seedlings were recovered normal growth with watering for 7 days. The survival rates of seedlings in WT, OE lines, and mEAR lines were about 40, 19.5–28, and 43–49 %, respectively (Fig. 3b). Student’s t test analyses showed thatthe differences among WT and two OE lines were significant(P\0 05 or P\0 01). Although there was no significantdifference between WT and mEAR lines, the survival rate in mEAR lines was slight higher than that in WT plants. These findings suggest that the Leu227/Ala substitution results in the complete loss of negative regulation of drought tolerance by OsERF3. We also found that the OE lines showed drought sensitive at the flowering stage (Fig. S4). Taken together, our research demonstrates that that the EAR motif is necessary for OsERF3 to negatively regulate drought tolerance in rice.  
 
[[File:zch3.png|200px|thumb|left|Fig. 3. Negative regulation of OsERF3 in the drought tolerance through its EAR motif..]]
 
 
 
===sequence analysis===
 
The rice genome encodes for 163 putative AP2/ERF family proteins based on their conserved AP2 domain sequence (Sharoni et al. 2011). OsERF3 encodes 235 amino acids
 
and belongs to class II ERF proteins. Sequence alignments showed that OsERF3 has a conserved AP2 DNA-binding domain and an EAR motif (DLNRPPP), which were highly
 
similar to the other class II ERF genes from Arabidopsis and rice. Especially, the three amino acids (DLN) were highly conserved in all candidate proteins (Fig. 1b, Fig. S2), suggesting they might play important roles in EAR motif-containing proteins. Analyses with phylogenetic tree of the protein sequences showed that OsERF3 was grouped in a cluster with Os05g0497300, with identity of 67.2 %. These two proteins showed a close evolutionary relationship with Os04g0610400, AtERF4, AtERF8, and AtERF11 (Fig. 1c), coinciding with the recent report on the syntenic relationships of rice ERF proteins (Rashid et al. 2012). Of these candidate genes, AtERF11 (Li et al. 2011), AtERF3 (Ohta et al. 2001), AtERF4 (Yang et al. 2005), and AtERF7 (Song et al. 2005) were proved to function as transcriptional repressors involved in modulating hormone response and stress tolerance. These analyses imply that OsERF3 might be a transcriptional repressor and play roles in mediating stress response.
 
  
 
==Labs working on this gene==
 
==Labs working on this gene==
*Institute of Crop Sciences/National Key Facility for Crop Gene Resources and Genetic Improvement, Chinese Academy of Agricultural Sciences, Beijing100081, China
+
* School of Biotechnology and Environmental Engineering, Myongji University, Yongin 449–728, Korea
*Shenzhen Institute of Breeding and Innovation, Chinese Academy of Agricultural Sciences, Shenzhen 518083, China
 
*Biotechnology Research Institute, Chinese Academy of Agricultural Sciences, Beijing 100081, China
 
*National Key Facility of Crop Gene Resources and Genetic Improvement, Beijing 100081, China
 
*Rice Institute, Hunan Academy of Agricultural Sciences, Changsha 410125, China
 
  
 
==References==
 
==References==
 
<references>
 
<references>
 
* <ref name="ref1">
 
* <ref name="ref1">
Zhang et al. BMC Genomics 2012, 13:461.Fan Zhang, Liyu Huang, Wensheng Wang, Xiuqin Zhao, Linghua Zhu, Binying Fu and Zhikang Li;Genome-wide gene expression profiling of introgressed indica rice alleles associated with seedling cold tolerance improvement in a japonica rice background
+
Oh SJ, Kim YS, Kwon CW, Park HK, Jeong JS, Kim JK. Overexpression of the
</ref>
+
transcription factor AP37 in rice improves grain yield under drought conditions.
* <ref name="ref2">
+
Plant Physiol. 2009 Jul;150(3):1368-79. doi: 10.1104/pp.109.137554. PubMed PMID:
Haiwen Zhang • Jianfei Zhang • Ruidang Quan •Xiaowu Pan • Liyun Wan • Rongfeng Huang;EAR motif mutation of rice OsERF3 alters the regulation of ethylene biosynthesis and drought tolerance. Planta (2013) 237:1443–1451
+
19429605; PubMed Central PMCID: PMC2705040.
 
</ref>
 
</ref>
 +
</references>
 +
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os01g0797600|
 
Description = Ethylene responsive element binding factor3 (OsERF3)|
 
Version = NM_001051054.1 GI:115440478 GeneID:4327621|
 
Length = 1090 bp|
 
Definition = Oryza sativa Japonica Group Os01g0797600, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
 
AP = Chromosome 1:35522840..35523929|
 
CDS = 35522920..35523627|
 
GCID = <gbrowseImage1>
 
name=NC_008394:35522840..35523929
 
source=RiceChromosome01
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008394:35522840..35523929
 
source=RiceChromosome01
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggcgcccagagcagctacggtggagaaggttgctgtggcgccacccaccgggcttggtcttggcgtcggcggaggtgtcggagccgggggtcctcactacaggggcgtccgcaagcgcccgtgggggcgttacgcagcggagatccgtgaccctgccaagaagagccgggtgtggctcggtacctacgacacggcagaggaggccgcccgcgcctacgacgccgccgctcgagagttccggggtgccaaggcaaaaacaaactttccgtttgcatcacagtcgatggtcggctgtggcggcagccccagcagcaatagcacggtagacaccggtggcggcggggttcagacgcctatgcgggccatgcctctgccgccgactctggacttggatttgttccaccgcgcggctgctgtgactgcagtcgccggcaccggcgttcgctttcctttcagaggatatcccgttgcacgtccagcaacgcatccttactttttctatgagcaggctgcagcggctgccgcagctgaggctggataccgtatgatgaagcttgcaccgccggtcaccgtggcggcggttgcacaaagtgactccgactcctcgtcggtggttgatctcgcgccgtcacctccagcggttacggcgaacaaggcggcagctttcgatctggatctgaaccggccgccgccggtagagaactag</cdnaseq>|
 
AA = <aaseq>MAPRAATVEKVAVAPPTGLGLGVGGGVGAGGPHYRGVRKRPWGR                    YAAEIRDPAKKSRVWLGTYDTAEEAARAYDAAAREFRGAKAKTNFPFASQSMVGCGGS                    PSSNSTVDTGGGGVQTPMRAMPLPPTLDLDLFHRAAAVTAVAGTGVRFPFRGYPVARP                    ATHPYFFYEQAAAAAAAEAGYRMMKLAPPVTVAAVAQSDSDSSSVVDLAPSPPAVTAN                    KAAAFDLDLNRPPPVEN</aaseq>|
 
DNA = <dnaseqindica>81..788#cacacccaaacccaacctcccaaaacacccacccggtttaccagagatccgcgcccgccacttgtaaacctgctgcacccatggcgcccagagcagctacggtggagaaggttgctgtggcgccacccaccgggcttggtcttggcgtcggcggaggtgtcggagccgggggtcctcactacaggggcgtccgcaagcgcccgtgggggcgttacgcagcggagatccgtgaccctgccaagaagagccgggtgtggctcggtacctacgacacggcagaggaggccgcccgcgcctacgacgccgccgctcgagagttccggggtgccaaggcaaaaacaaactttccgtttgcatcacagtcgatggtcggctgtggcggcagccccagcagcaatagcacggtagacaccggtggcggcggggttcagacgcctatgcgggccatgcctctgccgccgactctggacttggatttgttccaccgcgcggctgctgtgactgcagtcgccggcaccggcgttcgctttcctttcagaggatatcccgttgcacgtccagcaacgcatccttactttttctatgagcaggctgcagcggctgccgcagctgaggctggataccgtatgatgaagcttgcaccgccggtcaccgtggcggcggttgcacaaagtgactccgactcctcgtcggtggttgatctcgcgccgtcacctccagcggttacggcgaacaaggcggcagctttcgatctggatctgaaccggccgccgccggtagagaactagctcaggatgggttagctgacgactttgtagtttctctcttattttcttctttgatggatatttctctccgatgttttggtcctctgtgtttttgtttagtagcctgtgagagacggaagagccttgtaaatagtttttctgccgagggcgaaattcatcttgggatctgttaattagaacagatcatgccggcgatgagatggactaaaccgtggagtgtatgtattcctttatattagtatgaagaaattattcagaaagtcacaaaaatatctgtgcacactgagtttgattgacgtttt</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001051054.1 RefSeq:Os01g0797600]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 09:18, 6 March 2017

The rice Os01g0797600 was reported as AP37 in 2009 [1] by researchers from Korea.

Annotated Information

Gene Symbol

  • Os01g0797600 <=> AP37, OsAP37, OsERF3, OsERF#075, OsERF075, OsERF75, ERF75, AP2/EREBP#004, AP2/EREBP4, OsBIERF2, BIERF2

Function

  • AP37 (Os01g0797600), is AP2 domain-containing protein, it is found to be significantly up-regulated in both genotypes under cold stress.[1]
  • AP37 gene has the potential to improve drought tolerance in rice without causing undesirable growth phenotypes.

Expression

  • The overexpression of AP37 and AP59 in rice under the control of the constitutive promoter OsCc1 increased the tolerance to drought and high salinity at the vegetative stage.
  • Increased tolerance to low temperatures was observed only in OsCc1:AP37 plants. More importantly, the OsCc1:AP37 plants showed significantly enhanced drought tolerance in the field, which increased grain yield by 16% to 57% over controls under severe drought conditions, yet exhibited no significant difference under normal growth conditions.
  • In contrast, grain yield in OsCc1:AP59 plants in the field was reduced by 23% to 43% compared with controls under both normal and drought stress conditions.
  • Microarray experiments identified 10 and 38 genes that are up-regulated by AP37 and AP59, respectively, in addition to 37 genes that are commonly induced by both factors.

Labs working on this gene

  • School of Biotechnology and Environmental Engineering, Myongji University, Yongin 449–728, Korea

References

  1. 1.0 1.1 Oh SJ, Kim YS, Kwon CW, Park HK, Jeong JS, Kim JK. Overexpression of the transcription factor AP37 in rice improves grain yield under drought conditions. Plant Physiol. 2009 Jul;150(3):1368-79. doi: 10.1104/pp.109.137554. PubMed PMID: 19429605; PubMed Central PMCID: PMC2705040.

Structured Information