Difference between revisions of "Os01g0293100"

From RiceWiki
Jump to: navigation, search
(Evolution)
 
(3 intermediate revisions by 2 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''Os10g0544200''' was reported as '''''OsbHLH004''''' in 2006 <ref name="ref1" /> by researchers from the China. It is a member of bHLH transcription factor gene family.
  
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os10g0544200''''' '''''<=>''''' '''''OsbHLH004'''''
 +
 
===Function===
 
===Function===
Please input function information here.
+
* The basic/helix-loop-helix (bHLH) transcription factors and their homologs form a large family in plant and animal genomes.
 
+
* rice bHLH proteins can potentially participate in a variety of combinatorial interactions, endowing them with the capacity to regulate a multitude of transcriptional programs.
TDR INTERACTING PROTEIN2 (TIP2) is a basic helix-loop-helix (bHLH) protein, functions as a crucial switch in the meristemoid transition and differentiation during early anther development.
+
* bHLHs represent key regulatory components in transcriptional networks controlling a number of biological processes.
 
+
* Plant bHLHs have been reported to function in light signaling, hormone signaling, wound and drought stress responses, symbiotic ammonium transport, shoot branching, root, fruit and flower development, et al. <ref name="ref1" /> <ref name="ref2" /> <ref name="ref3" />
* The tip2 mutants display undifferentiated inner three anther wall layers.
 
 
 
* The tip2 anthers have prolonged periclinal cell division activity after the formation of the inner two anther wall layers via periclinal cell division.
 
 
 
* The tip2 displayed undegenerated callose around meiocytes, suggesting defective callose degeneration in the tip2 mutant.
 
 
 
* The tip2 mutants display abort tapetal programmed cell death.
 
 
 
 
 
TIP2 acts upstream of TDR and EAT1 and directly regulates the expression of TDR and EAT1, suggested that the bHLH proteins TIP2, TDR, and EAT1 play
 
a central role in regulating differentiation, morphogenesis, and degradation of anther somatic cell layers.
 
 
 
[[File:tip1.jpg]]
 
 
 
 
 
===Mutation and Phenotype===
 
Please input information here.
 
 
 
TIP2 locus on chromosome 1 between Z6.1-5 and Z6.2-1, two markers that defined a 170-kb region.
 
 
 
[[File:tip4.jpg]]
 
 
 
tip2 is a deletion of two continuous G nucleotides in it second exon.
 
 
 
[[File:tip5.jpg]]
 
 
 
Compared with the wild type, tip2 has normal vegetative growth, inflorescence and flower morphology. However, tip2 has smaller anthers and does not produce
 
mature pollen grains during reproductive stage.
 
 
 
[[File:tip6.jpg]]
 
 
 
 
 
Compared with the wild type,the three inner somatic layers of tip2 anthers displayed no obvious difference in cell shape during stages 6 to 8.Furthermore, DAPI staining showed mutation in TIP2 does not directly affect meiotic initiation but causes the arrest of meiosis.
 
The rice tapetum marker gene,LIPID TRANSFER PROTEIN45 (LTP45)was preferentially expressed in tapetal cells at stage 7 and stage 8 in wild-type anthers, whereas in tip2 anthers its expression was not detectable.
 
 
 
[[File:tip7.jpg]]
 
 
 
In the wild type, meiocytes formed tetrads after meiosis, tapetal cells became condensed and initiated PCD-promoted degeneration, and the middle layer also started to be degraded.By contrast, cell morphology of the three inner anther wall layers of tip2 anthers remained similar, and no obvious tapetal PCD ignals were detected.
 
 
 
[[File:tip8.jpg]]
 
 
 
aniline blue showed tip2
 
displayed undegenerated callose around meiocytes.
 
 
 
[[File:tip9.jpg]]
 
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
* Similar expression patterns suggest functional conservation between some rice bHLH genes and their close Arabidopsis homologs.
 
 
Using quantitative RT-PCR(qRT-PCR). TIP2 expression was specifically observed in anthers, from the meiosis stage to mitosis, with a maximum expression
 
level at stages 7 and 8.Interestingly, tip2 anthers displayed a lower level of TIP2 than the wild type from stage 6 to stage 8, but a higher level than the wild type after stage 9, when young microspores were released.
 
 
 
[[File:tip2.jpg]]
 
 
 
In situ hybridization showed strong expression of TIP2 in the middle layer and tapetum and weak expression in the endothecium in the wild type. By contrast, only background signal was detected in the same anther section with the sense probe.
 
 
 
[[File:tip3.jpg]]
 
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
* The studies of researchers indicate that the ancient bHLH gene family has likely expanded considerably during flowering plant evolution to include many relatively young members, allowing both the conservation and divergence of gene function.
  
The TIP2 cDNA encodes a putative bHLH transcription factor containing a conserved bHLH domain and a Domain Unknown Function domain, which shares high sequence similarity with EAT1 and is homologous to Arabidopsis AtbHLH010, AtbHLH089, and AtbHLH091.
+
You can also add sub-section(s) at will.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* Shanghai Jiao Tong University-Shanghai Institutes for Biological Sciences-Pennsylvania State University Joint Center for Life Sciences, Key Laboratory of Microbial Metabolism, Ministry of Education, School of Life Science and Biotechnology, Shanghai Jiao Tong University, Shanghai, People’s Republic of China, 200240
 +
* School of Life Science, Shanghai University, Shanghai, People’s Republic of China, 200444
 +
* School of Life Science, Xiamen University, Xiamen, People’s Republic of China, 361005
 +
* Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, Shanghai, People’s Republic of China, 200032
 +
* Department of Biology and the Huck Institutes of the Life Sciences, Pennsylvania State University, University Park, Pennsylvania 16802
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Li X, Duan X, Jiang H, Sun Y, Tang Y, Yuan Z, Guo J, Liang W, Chen L, Yin J,
 +
Ma H, Wang J, Zhang D. Genome-wide analysis of basic/helix-loop-helix
 +
transcription factor family in rice and Arabidopsis. Plant Physiol. 2006
 +
Aug;141(4):1167-84. PubMed PMID: 16896230; PubMed Central PMCID: PMC1533929.
 +
</ref>
 +
* <ref name="ref2">
 +
Carretero-Paulet L, Galstyan A, Roig-Villanova I, Martínez-García JF,
 +
Bilbao-Castro JR, Robertson DL. Genome-wide classification and evolutionary
 +
analysis of the bHLH family of transcription factors in Arabidopsis, poplar,
 +
rice, moss, and algae. Plant Physiol. 2010 Jul;153(3):1398-412. doi:
 +
10.1104/pp.110.153593. PubMed PMID: 20472752; PubMed Central PMCID: PMC2899937.
 +
</ref>
 +
* <ref name="ref3">
 +
Feller A, Machemer K, Braun EL, Grotewold E. Evolutionary and comparative
 +
analysis of MYB and bHLH plant transcription factors. Plant J. 2011
 +
Apr;66(1):94-116. doi: 10.1111/j.1365-313X.2010.04459.x. Review. PubMed PMID:
 +
21443626.
 +
 
 +
</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os01g0293100|
 
Description = Basic helix-loop-helix dimerisation region bHLH domain containing protein|
 
Version = NM_001049330.1 GI:115436073 GeneID:4325164|
 
Length = 2112 bp|
 
Definition = Oryza sativa Japonica Group Os01g0293100, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
 
AP = Chromosome 1:10712748..10714859|
 
CDS = 10713003..10713074,10713260..10713712,10713812..10714426|
 
GCID = <gbrowseImage1>
 
name=NC_008394:10712748..10714859
 
source=RiceChromosome01
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008394:10712748..10714859
 
source=RiceChromosome01
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atgtatcacccgcagtgcgagctcctgatgccgcttgagagcctggagatggacgtcggccagtcgcacctcgccgccgccgtcgcagcagccatgccgggggagctcaacttccacctcctccactcgctcgacgccgccgcggcggctgcctcctccaccgccgcctcggcctcctcccagcccaccgtcgactacttcttcggcggcgccgaccagcagccgccgccgccggcggcgatgcagtacgaccagctggcggcgccgcaccaccaccagacggtggccatgctgcgcgactactacggcggccactacccgccggcggcggcggcggcggcggccaccgaggcgtacttccgcggcgggccaaggacggccgggtcgtcgtcgctcgtgttcggcccggccgacgacgagtcggccttcatggtcggacccttcgagagctccccgacgccgcggtccggcggcggcaggaagcgtagccgcgccaccgccggcttccacggcggcgggccggccaacggcgtcgagaagaaggagaagcagcgccgcctgcggctcaccgagaagtacaacgccctcatgctcctcatccccaaccgcaccaaggaggatagagcgacggtgatctcagacgcgatcgagtacatccaggagctagggaggacggtggaggagctgacgctgctggtggagaagaagcggcggcggagggagatgcagggggacgtggtggacgcggcgacgtcgtcggtggtggcggggatggatcaggcggcggagagctcggagggcgaggtgatggcggcggcggcgatgggcgcggtggcaccgccgccgcggcaggcgccgatccggagcacgtacatccagcggcggagcaaggagacgttcgtggacgtgcggatcgtggaggacgacgtgaacatcaagctcaccaagcgccgccgcgacggctgtctcgccgccgcgtcgcgcgcgctggacgacctccgcctcgacctcgtccacctctccggcggcaagatcggcgactgccacatctacatgttcaacaccaagattcattcgggatctccagtgtttgcaagtgcagtggccagcaggctgattgaagtggtggatgagtactaa</cdnaseq>|
 
AA = <aaseq>MYHPQCELLMPLESLEMDVGQSHLAAAVAAAMPGELNFHLLHSL                    DAAAAAASSTAASASSQPTVDYFFGGADQQPPPPAAMQYDQLAAPHHHQTVAMLRDYY                    GGHYPPAAAAAAATEAYFRGGPRTAGSSSLVFGPADDESAFMVGPFESSPTPRSGGGR                    KRSRATAGFHGGGPANGVEKKEKQRRLRLTEKYNALMLLIPNRTKEDRATVISDAIEY                    IQELGRTVEELTLLVEKKRRRREMQGDVVDAATSSVVAGMDQAAESSEGEVMAAAAMG                    AVAPPPRQAPIRSTYIQRRSKETFVDVRIVEDDVNIKLTKRRRDGCLAAASRALDDLR                    LDLVHLSGGKIGDCHIYMFNTKIHSGSPVFASAVASRLIEVVDEY</aaseq>|
 
DNA = <dnaseqindica>1786..1857#1148..1600#434..1048#aagaaaccaactgctttctcctacccaatatcacccttgccccttttatatactcttcctctcatcaccttctcgatcggcctctctcctctcctctcatcagctcacacccccaaccaacaaacctagttaatttagctctagttggttcatccctgctgcactgcgagctcaagtaatcgatctgagctctgaagaaaaaggtctgtttcaaattgaaccctttcatctcatcttctcattactgtttgattcattaattctagtaatttagagtttaaaccatcgcttttctttttgtgtgtgttcttgcatatgcttggacgattttgagtttgttctttaaatttgggcttgaacataggttgattaagcgagaagagtttcatggtttggattcttgatttgttgcaggtggtagagtgcgaggaagatgtatcacccgcagtgcgagctcctgatgccgcttgagagcctggagatggacgtcggccagtcgcacctcgccgccgccgtcgcagcagccatgccgggggagctcaacttccacctcctccactcgctcgacgccgccgcggcggctgcctcctccaccgccgcctcggcctcctcccagcccaccgtcgactacttcttcggcggcgccgaccagcagccgccgccgccggcggcgatgcagtacgaccagctggcggcgccgcaccaccaccagacggtggccatgctgcgcgactactacggcggccactacccgccggcggcggcggcggcggcggccaccgaggcgtacttccgcggcgggccaaggacggccgggtcgtcgtcgctcgtgttcggcccggccgacgacgagtcggccttcatggtcggacccttcgagagctccccgacgccgcggtccggcggcggcaggaagcgtagccgcgccaccgccggcttccacggcggcgggccggccaacggcgtcgagaagaaggagaagcagcgccgcctgcggctcaccgagaagtacaacgccctcatgctcctcatccccaaccgcaccaaggtatatcacatgccctagctaccatcgtcttcggtagttcgatctcttcttgtgttcatccatggatcgatcgatgatgattttgtctttctttttcaggaggatagagcgacggtgatctcagacgcgatcgagtacatccaggagctagggaggacggtggaggagctgacgctgctggtggagaagaagcggcggcggagggagatgcagggggacgtggtggacgcggcgacgtcgtcggtggtggcggggatggatcaggcggcggagagctcggagggcgaggtgatggcggcggcggcgatgggcgcggtggcaccgccgccgcggcaggcgccgatccggagcacgtacatccagcggcggagcaaggagacgttcgtggacgtgcggatcgtggaggacgacgtgaacatcaagctcaccaagcgccgccgcgacggctgtctcgccgccgcgtcgcgcgcgctggacgacctccgcctcgacctcgtccacctctccggcggcaagatcggcgactgccacatctacatgttcaacaccaaggtcacaacaaccaactaaaaatatccccgcgtttatctacaaaactaaccaatctcataatagtaattaattctagaacaattttatcgtgttgtgatcaacataaacctatatatgcaaataaattgctgctagttaatctcatcattgatttattattgtttatttggatgcgatgcatgcagattcattcgggatctccagtgtttgcaagtgcagtggccagcaggctgattgaagtggtggatgagtactaactagctcgagctagctaattagccgaccgaccgatcgatatgatgaaagtttctatgttgctagctagctagggttcttggatgcatgagtactgagtagctctttaattaatttccttttaattttagactgtttaatttggattggtaaagactcgtgttagcttttgggagatctttggtatgtcatggtttgcatgtattattttggtctacttggataaataattgatgctctttgagacgttaattaat</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001049330.1 RefSeq:Os01g0293100]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 14:33, 22 March 2017

The rice Os10g0544200 was reported as OsbHLH004 in 2006 [1] by researchers from the China. It is a member of bHLH transcription factor gene family.

Annotated Information

Gene Symbol

  • Os10g0544200 <=> OsbHLH004

Function

  • The basic/helix-loop-helix (bHLH) transcription factors and their homologs form a large family in plant and animal genomes.
  • rice bHLH proteins can potentially participate in a variety of combinatorial interactions, endowing them with the capacity to regulate a multitude of transcriptional programs.
  • bHLHs represent key regulatory components in transcriptional networks controlling a number of biological processes.
  • Plant bHLHs have been reported to function in light signaling, hormone signaling, wound and drought stress responses, symbiotic ammonium transport, shoot branching, root, fruit and flower development, et al. [1] [2] [3]

Expression

  • Similar expression patterns suggest functional conservation between some rice bHLH genes and their close Arabidopsis homologs.

Evolution

  • The studies of researchers indicate that the ancient bHLH gene family has likely expanded considerably during flowering plant evolution to include many relatively young members, allowing both the conservation and divergence of gene function.

You can also add sub-section(s) at will.

Labs working on this gene

  • Shanghai Jiao Tong University-Shanghai Institutes for Biological Sciences-Pennsylvania State University Joint Center for Life Sciences, Key Laboratory of Microbial Metabolism, Ministry of Education, School of Life Science and Biotechnology, Shanghai Jiao Tong University, Shanghai, People’s Republic of China, 200240
  • School of Life Science, Shanghai University, Shanghai, People’s Republic of China, 200444
  • School of Life Science, Xiamen University, Xiamen, People’s Republic of China, 361005
  • Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, Shanghai, People’s Republic of China, 200032
  • Department of Biology and the Huck Institutes of the Life Sciences, Pennsylvania State University, University Park, Pennsylvania 16802

References

  1. 1.0 1.1 Li X, Duan X, Jiang H, Sun Y, Tang Y, Yuan Z, Guo J, Liang W, Chen L, Yin J, Ma H, Wang J, Zhang D. Genome-wide analysis of basic/helix-loop-helix transcription factor family in rice and Arabidopsis. Plant Physiol. 2006 Aug;141(4):1167-84. PubMed PMID: 16896230; PubMed Central PMCID: PMC1533929.
  2. Carretero-Paulet L, Galstyan A, Roig-Villanova I, Martínez-García JF, Bilbao-Castro JR, Robertson DL. Genome-wide classification and evolutionary analysis of the bHLH family of transcription factors in Arabidopsis, poplar, rice, moss, and algae. Plant Physiol. 2010 Jul;153(3):1398-412. doi: 10.1104/pp.110.153593. PubMed PMID: 20472752; PubMed Central PMCID: PMC2899937.
  3. Feller A, Machemer K, Braun EL, Grotewold E. Evolutionary and comparative analysis of MYB and bHLH plant transcription factors. Plant J. 2011 Apr;66(1):94-116. doi: 10.1111/j.1365-313X.2010.04459.x. Review. PubMed PMID: 21443626.

Structured Information