|
|
| (27 intermediate revisions by 2 users not shown) |
| Line 1: |
Line 1: |
| − | The rice '''''atp9''''' sequence was first reported by Grabau et al. (1990) in soybean mitochondria.This gene encodes an extremely hydrophobic protein that, when relocated, is particularly challenging to import into mitochondria. <ref name="ref1" /><ref name="ref3" />.
| + | Please input one-sentence summary here. |
| | | | |
| − | {{Mitochondrion|
| + | ==Annotated Information== |
| − | GeneName = atp9|
| + | ===Function=== |
| − | Description = ATP synthase F0 subunit 9|
| + | Please input function information here. |
| − | Version = GeneID:6450130|
| |
| − | Length = 225 bp|
| |
| − | Definition = Oryza sativa Japonica Group ''atp9'', Mitochondrion gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| | | | |
| − | ORGANISM Oryza sativa Japonica Group
| + | ===Expression=== |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| + | Please input expression information here. |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| + | |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| + | ===Evolution=== |
| − | |
| + | Please input evolution information here. |
| − | Chromosome = [[:category:Japonica Mitochondrion|Mitochondrion]]|
| + | |
| − | AP = Mitochondrion:263141..263365|
| + | You can also add sub-section(s) at will. |
| − | CDS = 263141..263365|
| + | |
| − | GCID = <gbrowseImage1>
| + | ==Labs working on this gene== |
| − | name=NC_011033:263141..263365
| + | Please input related labs here. |
| − | source=Rice_Japonica_Mitochondrion
| + | |
| − | preset=GeneLocation
| + | ==References== |
| − | </gbrowseImage1>|
| + | Please input cited references here. |
| − | GSID = <gbrowseImage2>
| + | |
| − | name=NC_011033:263141..263365
| + | ==Structured Information== |
| − | source=Rice_Japonica_Mitochondrion
| + | [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Mitochondrion]] |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | AA = <aaseq>MLEGAKLIGAGAATIALAGAAVGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFALMMAFLILFVF</aaseq>|
| |
| − | DNA = <dnaseqindica>1..225#atgttagaaggagctaaatcaataggtgccggagctgctacaattgctttagcgggagctgctgtcggtattggaaacgtcctcagttcttcgattcattccgtggcgcgaaatccttcattggctaaacaattatttggttatgccattttgggctttgctctcaccgaagctattgcattgtttgccccaatgatggcctttctgatttcattcgttttccga</dnaseqindica>|
| |
| − | }}
| |
| − | [[Category:Genes]] | |
| − | [[Category:Japonica mRNA]]
| |
| − | [[Category:Oryza Sativa Japonica Group]] | |
| − | [[Category:Japonica Genes]] | |
| − | [[Category:Japonica Mitochondrion]]
| |
| − | [[Category:Mitochondrion]]
| |
Please input one-sentence summary here.
Annotated Information
Function
Please input function information here.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
