|
|
| (26 intermediate revisions by 2 users not shown) |
| Line 1: |
Line 1: |
| | + | Please input one-sentence summary here. |
| | | | |
| − | == The rice '''''atp9''''' sequence was first reported by Grabau et al. (1990) in soybean mitochondria.This gene encodes an extremely hydrophobic protein that, when relocated, is particularly challenging to import into mitochondria. <ref name="ref1" /><ref name="ref3" />.
| |
| | ==Annotated Information== | | ==Annotated Information== |
| | ===Function=== | | ===Function=== |
| − | atp9 gene, which encodes ATPase subunit 9, is an important functional gene in mitochondria, and is closely related with energy supply.RNA editing of atp9 gene was associated with male sterility in plants<ref name="ref2" />.
| + | Please input function information here. |
| − | The protein it encodes has only two transmembrane segments, yet is extremely hydrophobic and classified as a proteolipid because it can easily be extracted from mitochondria with organic solvents . Subunit 9 is present in several copies , forming a ring structure that is an essential component of the ATP synthase proton-translocating domain . During proton transport, the subunit 9-ring rotates, resulting in conformational changes that favour the production of ATP by the catalytic head of the ATP synthase and its release into the mitochondrial matrix.<ref name="ref3" />
| |
| | | | |
| − | {{Mitochondrion|
| + | ===Expression=== |
| − | GeneName = atp9|
| + | Please input expression information here. |
| − | Description = ATP synthase F0 subunit 9|
| |
| − | Version = GeneID:6450130|
| |
| − | Length = 225 bp|
| |
| − | Definition = Oryza sativa Japonica Group ''atp9'', Mitochondrion gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| | | | |
| − | ORGANISM Oryza sativa Japonica Group
| + | ===Evolution=== |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| + | Please input evolution information here. |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| + | |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| + | You can also add sub-section(s) at will. |
| − | |
| + | |
| − | Chromosome = [[:category:Japonica Mitochondrion|Mitochondrion]]|
| + | ==Labs working on this gene== |
| − | AP = Mitochondrion:263141..263365|
| + | Please input related labs here. |
| − | CDS = 263141..263365|
| + | |
| − | GCID = <gbrowseImage1>
| + | ==References== |
| − | name=NC_011033:263141..263365
| + | Please input cited references here. |
| − | source=Rice_Japonica_Mitochondrion
| + | |
| − | preset=GeneLocation
| + | ==Structured Information== |
| − | </gbrowseImage1>|
| + | [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Mitochondrion]] |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_011033:263141..263365
| |
| − | source=Rice_Japonica_Mitochondrion
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | AA = <aaseq>MLEGAKLIGAGAATIALAGAAVGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFALMMAFLILFVF</aaseq>|
| |
| − | DNA = <dnaseqindica>1..225#atgttagaaggagctaaatcaataggtgccggagctgctacaattgctttagcgggagctgctgtcggtattggaaacgtcctcagttcttcgattcattccgtggcgcgaaatccttcattggctaaacaattatttggttatgccattttgggctttgctctcaccgaagctattgcattgtttgccccaatgatggcctttctgatttcattcgttttccga</dnaseqindica>|
| |
| − | }}
| |
| − | [[Category:Genes]] | |
| − | [[Category:Japonica mRNA]]
| |
| − | [[Category:Oryza Sativa Japonica Group]] | |
| − | [[Category:Japonica Genes]]
| |
| − | [[Category:Japonica Mitochondrion]] | |
| − | [[Category:Mitochondrion]
| |
Please input one-sentence summary here.
Annotated Information
Function
Please input function information here.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information